KEGG   Homo sapiens (human): 151648
Entry
151648            CDS       T01001                                 
Symbol
SGO1, CAID, NY-BR-85, SGO, SGOL1
Name
(RefSeq) shugoshin 1
  KO
K11580  shugoshin-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
Network
nt06512  Chromosome cohesion and segregation
  Element
N01485  Cohesin dissociation in prophase
Disease
H02122  Chronic atrial and intestinal dysrhythmia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    151648 (SGO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    151648 (SGO1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    Shugoshin
     151648 (SGO1)
SSDB
Motif
Pfam: Shugoshin_C Shugoshin_N Menin
Other DBs
NCBI-GeneID: 151648
NCBI-ProteinID: NP_001012410
OMIM: 609168
HGNC: 25088
Ensembl: ENSG00000129810
Pharos: Q5FBB7(Tbio)
UniProt: Q5FBB7
Structure
LinkDB
Position
3:complement(20160593..20186886)
AA seq 561 aa
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDN
NKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSS
GMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKS
TDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFERVGFLDPLVNMHIPEN
VQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANR
RKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREE
NNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGS
KPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTA
SVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVR
EFVSRFPDCRKCKLETHICLR
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggccaaggaaagatgcctgaaaaagtcctttcaagatagtcttgaagacataaagaag
cgaatgaaagagaaaaggaataaaaacttggcagagattggcaaacgcaggtcttttata
gctgcaccatgccaaataatcaccaacacttctacactgctgaaaaattaccaagacaac
aacaaaatgttagttttagctttggaaaatgaaaaatccaaagtgaaagaagcccaagat
atcatcctacagctgagaaaagaatgttactatctcacatgtcagctatatgcattgaaa
ggaaaacttacatcacaacaaacagtagaacctgctcagaaccaggaaatatgttcctct
ggaatggaccccaatagtgatgacagctccagaaatttatttgtgaaggatttaccgcaa
attcctcttgaagaaactgaacttccaggacaaggagaatcatttcaaatagaagatcag
atacctactattcctcaagacacactgggagttgattttgattcaggtgaagctaagtct
actgataatgtcttacctagaactgtatctgttcgtagcagtttaaagaaacattgtaac
agtatatgtcagtttgatagcttggatgattttgaaaccagtcatttggcagggaagtct
tttgaattcgaaagagttggatttttagacccactagtaaacatgcacatacctgaaaat
gtacaacacaatgcttgtcaatggagcaaggaccaagttaacttatcaccaaagctgatt
cagccaggaacgtttactaaaacaaaagaagacattttagaatctaaatctgaacaaact
aaaagtaagcaaagagatacacaagaaagaaaaagagaagagaaaagaaaagctaacagg
agaaaatcaaaacgtatgtcaaaatataaagagaataaaagcgaaaataaaaaaactgtt
ccccaaaaaaaaatgcacaaatctgtcagttccaatgatgcttacaattttaatttggaa
gagggtgttcatcttactcctttccgacaaaaagtgagcaatgactctaatagagaagaa
aacaacgagtctgaagtgagcctctgtgaatcaagtggttcaggagatgattccgatgac
ctctatttgcccacttgcaagtacattcagaatcccacgagcaattcagatagaccagtc
accaggcctctagctaaaagagcactgaaatacacagatgaaaaagagacggagggttct
aagccaacaaaaactcctaccactacaccacctgaaactcagcagtcacctcatcttagc
ctgaaggatatcaccaatgtctccttgtatcctgttgtgaaaatcagaagactttctctt
tctccaaaaaagaataaagcaagcccagcagtggctctgcctaaacgtaggtgcacagcc
agcgtgaactataaggagcccaccctcgcttcgaaactgagaagaggggacccttttaca
gatttgtgttttttgaattctcctattttcaagcagaaaaaggatttgagacgttctaaa
aaaagagccctggaggtatcacctgccaaagaagcaatttttattttatattatgttcga
gaatttgtttcgagattcccagactgtaggaaatgtaaacttgaaacccacatctgcttg
aggtaa

DBGET integrated database retrieval system