KEGG   Homo sapiens (human): 151648
Entry
151648            CDS       T01001                                 

Gene name
SGO1, CAID, NY-BR-85, SGO, SGOL1
Definition
(RefSeq) shugoshin 1
  KO
K11580  shugoshin-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
Disease
H02122  Chronic atrial and intestinal dysrhythmia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    151648 (SGO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    151648 (SGO1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    Shugoshin
     151648 (SGO1)
SSDB
Motif
Pfam: Shugoshin_N Shugoshin_C DUF2828 Menin
Other DBs
NCBI-GeneID: 151648
NCBI-ProteinID: NP_001012410
OMIM: 609168
HGNC: 25088
Ensembl: ENSG00000129810
Vega: OTTHUMG00000130479
Pharos: Q5FBB7(Tbio)
UniProt: Q5FBB7
LinkDB
Structure
PDB: 
3FGA

Position
3p24.3
AA seq 561 aa
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDN
NKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSS
GMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKS
TDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFERVGFLDPLVNMHIPEN
VQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANR
RKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREE
NNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGS
KPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTA
SVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVR
EFVSRFPDCRKCKLETHICLR
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggccaaggaaagatgcctgaaaaagtcctttcaagatagtcttgaagacataaagaag
cgaatgaaagagaaaaggaataaaaacttggcagagattggcaaacgcaggtcttttata
gctgcaccatgccaaataatcaccaacacttctacactgctgaaaaattaccaagacaac
aacaaaatgttagttttagctttggaaaatgaaaaatccaaagtgaaagaagcccaagat
atcatcctacagctgagaaaagaatgttactatctcacatgtcagctatatgcattgaaa
ggaaaacttacatcacaacaaacagtagaacctgctcagaaccaggaaatatgttcctct
ggaatggaccccaatagtgatgacagctccagaaatttatttgtgaaggatttaccgcaa
attcctcttgaagaaactgaacttccaggacaaggagaatcatttcaaatagaagatcag
atacctactattcctcaagacacactgggagttgattttgattcaggtgaagctaagtct
actgataatgtcttacctagaactgtatctgttcgtagcagtttaaagaaacattgtaac
agtatatgtcagtttgatagcttggatgattttgaaaccagtcatttggcagggaagtct
tttgaattcgaaagagttggatttttagacccactagtaaacatgcacatacctgaaaat
gtacaacacaatgcttgtcaatggagcaaggaccaagttaacttatcaccaaagctgatt
cagccaggaacgtttactaaaacaaaagaagacattttagaatctaaatctgaacaaact
aaaagtaagcaaagagatacacaagaaagaaaaagagaagagaaaagaaaagctaacagg
agaaaatcaaaacgtatgtcaaaatataaagagaataaaagcgaaaataaaaaaactgtt
ccccaaaaaaaaatgcacaaatctgtcagttccaatgatgcttacaattttaatttggaa
gagggtgttcatcttactcctttccgacaaaaagtgagcaatgactctaatagagaagaa
aacaacgagtctgaagtgagcctctgtgaatcaagtggttcaggagatgattccgatgac
ctctatttgcccacttgcaagtacattcagaatcccacgagcaattcagatagaccagtc
accaggcctctagctaaaagagcactgaaatacacagatgaaaaagagacggagggttct
aagccaacaaaaactcctaccactacaccacctgaaactcagcagtcacctcatcttagc
ctgaaggatatcaccaatgtctccttgtatcctgttgtgaaaatcagaagactttctctt
tctccaaaaaagaataaagcaagcccagcagtggctctgcctaaacgtaggtgcacagcc
agcgtgaactataaggagcccaccctcgcttcgaaactgagaagaggggacccttttaca
gatttgtgttttttgaattctcctattttcaagcagaaaaaggatttgagacgttctaaa
aaaagagccctggaggtatcacctgccaaagaagcaatttttattttatattatgttcga
gaatttgtttcgagattcccagactgtaggaaatgtaaacttgaaacccacatctgcttg
aggtaa

DBGET integrated database retrieval system