KEGG   Homo sapiens (human): 153527
Entry
153527            CDS       T01001                                 
Symbol
ZMAT2, Ptg-12, Snu23
Name
(RefSeq) zinc finger matrin-type 2
  KO
K12848  U4/U6.U5 tri-snRNP component SNU23
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    153527 (ZMAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    153527 (ZMAT2)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    153527 (ZMAT2)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    153527 (ZMAT2)
SSDB
Motif
Pfam: zf-C2H2_jaz zf-met zf-U1 SNRNP27 Cgr1 DUF6277 DUF4250 Tra1_central zf-C2H2
Other DBs
NCBI-GeneID: 153527
NCBI-ProteinID: NP_653324
HGNC: 26433
Ensembl: ENSG00000146007
Pharos: Q96NC0(Tdark)
UniProt: Q96NC0
Structure
LinkDB
Position
5:140700447..140706686
AA seq 199 aa
MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLES
KLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLD
QVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEED
DEMAAVMGFSGFGSTKKSY
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcgtcgggcagcgggacaaaaaacttggactttcgccgaaagtgggacaaagatgaa
tatgagaaactcgccgagaagaggctcacggaagagagagaaaagaaagatggaaaacca
gtgcagcctgtcaagcgagagcttttacggcatagggactacaaggtggacttggaatcc
aagcttgggaagacaattgtcattaccaagacaacccctcaatctgagatgggaggatat
tactgcaatgtctgtgactgtgtggtgaaggactccatcaactttctggatcacattaat
ggaaagaaacatcagagaaacctgggcatgtctatgcgtgtggaacgttccaccctggat
caggtgaagaaacgttttgaggtcaacaagaagaagatggaagagaagcagaaggattat
gattttgaggaaaggatgaaggagctcagagaagaggaggaaaaggccaaagcgtacaag
aaagagaaacagaaggagaagaaaaggagggctgaggaggacttgacatttgaggaggac
gatgagatggcagctgtgatgggcttctctggctttggttccaccaagaagagttactga

DBGET integrated database retrieval system