KEGG   Homo sapiens (human): 164091
Entry
164091            CDS       T01001                                 
Symbol
PAQR7, MPRA, PGLP, mSR
Name
(RefSeq) progestin and adipoQ receptor family member 7
  KO
K25039  membrane progestin receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06214  PI3K signaling
  Element
N01356  Membrane-initiated progesterone signaling pathway
N01357  P4/MPA to membrane-initiated progesterone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    164091 (PAQR7)
SSDB
Motif
Pfam: HlyIII
Other DBs
NCBI-GeneID: 164091
NCBI-ProteinID: NP_848509
OMIM: 607779
HGNC: 23146
Ensembl: ENSG00000182749
Pharos: Q86WK9(Tbio)
UniProt: Q86WK9
LinkDB
Position
1:complement(25861484..25875708)
AA seq 346 aa
MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRF
YFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSF
SALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAF
LAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRIFVSSDPTTDDPALLY
HKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEAR
RPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggccatggcccagaaactcagccacctcctgccgagtctgcggcaggtcatccaggag
cctcagctatctctgcagccagagcctgtcttcacggtggatcgagctgaggtgccgccg
ctcttctggaagccgtacatctatgcgggctaccggccgctgcatcagacctggcgcttc
tatttccgcacgctgttccagcagcacaacgaggccgtgaatgtctggacccacctgctg
gcggccctggtactgctgctgcggctggccctctttgtggagaccgtggacttctgggga
gacccacacgccctgcccctcttcatcattgtccttgcctctttcacctacctctccttc
agtgccttggctcacctcctgcaggccaagtctgagttctggcattacagcttcttcttc
ctggactatgtgggggtggccgtgtaccagtttggcagtgccttggcacacttctactat
gctatcgagcccgcctggcatgcccaggtgcaggctgtttttctgcccatggctgccttt
ctcgcctggctttcctgcattggctcctgctataacaagtacatccagaaaccaggcctg
ctgggccgcacatgccaggaggtgccctccgtcctggcctacgcactggacattagtcct
gtggtgcatcgtatcttcgtgtcctccgaccccaccacggatgatccagctcttctctac
cacaagtgccaggtggtcttctttctgctggctgctgccttcttctctaccttcatgccc
gagcgctggttccctggcagctgccatgtcttcgggcagggccaccaacttttccacatc
ttcttggtgctgtgcacgctggctcagctggaggctgtggcactggactatgaggcccga
cggcccatctatgagcctctgcacacgcactggcctcacaacttttctggcctcttcctg
ctcacggtgggcagcagcatcctcactgcattcctcctgagccagctggtacagcgcaaa
cttgatcagaagaccaagtga

KEGG   Homo sapiens (human): 85315
Entry
85315             CDS       T01001                                 
Symbol
PAQR8, C6orf33, LMPB1, MPRB
Name
(RefSeq) progestin and adipoQ receptor family member 8
  KO
K25040  membrane progestin receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06214  PI3K signaling
  Element
N01356  Membrane-initiated progesterone signaling pathway
N01357  P4/MPA to membrane-initiated progesterone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    85315 (PAQR8)
SSDB
Motif
Pfam: HlyIII DUF5504
Other DBs
NCBI-GeneID: 85315
NCBI-ProteinID: NP_588608
OMIM: 607780
HGNC: 15708
Ensembl: ENSG00000170915
Pharos: Q8TEZ7(Tbio)
UniProt: Q8TEZ7 B3KXW6
LinkDB
Position
6:52362151..52407777
AA seq 354 aa
MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGH
EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSI
TYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFL
PAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGC
QEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAI
LLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgacgaccgccatcttggagcgcctgagcaccctgtcggtcagcgggcagcagctgcgc
cgcctgcccaagatcctggaggatgggcttcccaagatgccttgcactgtcccagaaacg
gatgtgccccagctcttccgggagccttacatccgcaccggctaccgccccacggggcac
gagtggcgctactacttcttcagcctctttcagaaacacaacgaggtggtcaacgtctgg
acccatttactggcagccctggccgtcctcttgcgattctgggcctttgccgaggctgag
gccttgccatgggcgtctacccactccctgcctctgctcctcttcatcctgtcgtcaatc
acttacctcacctgcagccttctggcccacctgctgcagtccaagtcagagctctcccac
tacaccttctactttgtggactatgttggcgtgagcgtttaccaatatggcagtgctttg
gctcatttcttctacagctctgaccaggcctggtatgaccggttctggcttttcttcttg
ccagcagctgccttctgtggctggttatcttgtgctggctgttgctatgccaaatatcgt
taccggaggccttatccagtcatgaggaagatctgtcaagtggtgccagcaggtctggct
tttatcctagacatcagccctgtggcacaccgtgtggcgctctgtcacctggctggctgc
caggagcaagcagcctggtaccacaccctccagatcctcttcttcctggttagcgcttat
ttcttctcctgccccgtgcctgagaagtacttcccgggttcctgtgacatcgtgggccat
gggcatcagatcttccatgcatttctgtccatctgtacgctctcccagctggaggccatc
ctcctggactaccaggggcggcaggagatcttcctgcagcgccatggacccctatctgtc
cacatggcctgcctctccttcttcttcctggctgcctgcagtgctgccaccgcagccctt
ctgaggcacaaagtcaaggccagactgaccaagaaagattcctga

KEGG   Homo sapiens (human): 54852
Entry
54852             CDS       T01001                                 
Symbol
PAQR5, MPRG
Name
(RefSeq) progestin and adipoQ receptor family member 5
  KO
K25041  membrane progestin receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06214  PI3K signaling
  Element
N01356  Membrane-initiated progesterone signaling pathway
N01357  P4/MPA to membrane-initiated progesterone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    54852 (PAQR5)
SSDB
Motif
Pfam: HlyIII
Other DBs
NCBI-GeneID: 54852
NCBI-ProteinID: NP_001098024
OMIM: 607781
HGNC: 29645
Ensembl: ENSG00000137819
Pharos: Q9NXK6(Tdark)
UniProt: Q9NXK6 A0A024R607
LinkDB
Position
15:69298912..69407780
AA seq 330 aa
MLSLKLPRLFSIDQIPQVFHEQGILFGYRHPQSSATACILSLFQMTNETLNIWTHLLPFW
FFAWRFVTALYMTDIKNDSYSWPMLVYMCTSCVYPLVSSCAHTFSSMSKNARHICYFLDY
GAVNLFSLGSAIAYSAYTFPDALMCTTFHDYYVALAVLNTILSTGLSCYSRFLEIQKPRL
CKVIRVLAFAYPYTWDSLPIFYRLFLFPGESAQNEATSYHQKHMIMTLLASFLYSAHLPE
RLAPGRFDYIGHSHQLFHVCVILATHMQMEAILLDKTLRKEWLLATSKPFSFSQIAGAIL
LCIIFSLSNIIYFSAALYRIPKPELHKKET
NT seq 993 nt   +upstreamnt  +downstreamnt
atgctgagcctgaagctccccaggctgtttagcatagaccagataccccaggtgttccat
gagcaaggcatcctgttcggctaccgccatccacagagttctgccactgcctgcatcctc
agccttttccaaatgaccaatgagactctcaacatttggactcacttgctgcccttctgg
ttctttgcatggaggtttgtgactgcactgtatatgacagacatcaagaatgacagctac
tcctggcccatgcttgtgtacatgtgcaccagctgcgtgtacccacttgtgtccagctgt
gcgcacaccttcagctctatgtccaagaatgcccggcacatttgctacttcctggactat
ggtgccgtcaacctcttcagcctgggctcagccattgcctactctgcatacacgttcccg
gatgcgctcatgtgcaccactttccatgactactacgtggccctggctgtactgaacacc
atcctcagcacaggcctctcctgctactccaggtttcttgaaatccagaagcccagactc
tgtaaggtgattcgtgtcctcgcctttgcttatccgtacacctgggactccctccccatc
ttctacaggctattcctgttcccaggggagagtgcacaaaatgaagccacctcgtaccac
cagaagcacatgatcatgaccctcctggcctctttcttgtactctgcacatctgccagaa
cgcctagcccctggacgctttgactacatcggtcacagtcaccagctgtttcacgtgtgt
gtgatcctggccacgcacatgcagatggaagccatacttctggacaagactctgaggaag
gaatggctcctggccacctccaagcccttctctttctctcagatagctggagccatactt
ctgtgcatcatcttcagcctcagcaacataatttatttctcagctgctctgtatcggatt
cccaagccagaattacataaaaaagaaacatga

DBGET integrated database retrieval system