KEGG   Homo sapiens (human): 1733
Entry
1733              CDS       T01001                                 
Symbol
DIO1, 5DI, THMA2, TXDI1
Name
(RefSeq) iodothyronine deiodinase 1
  KO
K01562  type I thyroxine 5'-deiodinase [EC:1.21.99.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Drug target
Propylthiouracil: D00562<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    1733 (DIO1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.99  With unknown physiological acceptors
    1.21.99.4  thyroxine 5'-deiodinase
     1733 (DIO1)
SSDB
Motif
Pfam: T4_deiodinase SCIMP CoV_NSP4_N SWIM
Other DBs
NCBI-GeneID: 1733
NCBI-ProteinID: NP_000783
OMIM: 147892
HGNC: 2883
Ensembl: ENSG00000211452
Pharos: P49895(Tclin)
UniProt: P49895 A8K415
LinkDB
Position
1:53894187..53911086
AA seq 249 aa
MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDN
WIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLN
FGSCTUPSFMFKFDQFKRLIEDFSSIADFLVIYIEEAHASDGWAFKNNMDIRNHQNLQDR
LQAAHLLLARSPQCPVVVDTMQNQSSQLYAALPERLYIIQEGRILYKGKSGPWNYNPEEV
RAVLEKLHS
NT seq 750 nt   +upstreamnt  +downstreamnt
atggggctgccccagccagggctgtggctgaagaggctctgggtgctcttggaggtggct
gtgcatgtggtcgtgggtaaagtgcttctgatattgtttccagacagagtcaagcggaac
atcctggccatgggcgagaagacgggtatgaccaggaacccccatttcagccacgacaac
tggataccaacctttttcagcacccagtatttctggttcgtcttgaaggtccgttggcag
cgactagaggacacgactgagctagggggtctggccccaaactgcccggtggtccgcctc
tcaggacagaggtgcaacatttgggagtttatgcaaggtaataggccactggtgctgaat
tttggaagttgtacctgaccttcatttatgttcaaatttgaccagttcaagaggcttatt
gaagactttagttccatagcagattttcttgtcatttacattgaagaagcacatgcatca
gatggctgggcttttaagaacaacatggacatcagaaatcaccagaaccttcaggatcgc
ctgcaggcagcccatctactgctggccaggagcccccagtgccctgtggtggtggacacc
atgcagaaccagagcagccagctctacgcagcactgcctgagaggctctacataatccag
gagggcaggatcctctacaagggtaaatctggcccttggaactacaacccagaggaagtt
cgtgctgttctggaaaagctccacagttaa

KEGG   Homo sapiens (human): 1734
Entry
1734              CDS       T01001                                 
Symbol
DIO2, 5DII, D2, DIOII, SELENOY, SelY, TXDI2
Name
(RefSeq) iodothyronine deiodinase 2
  KO
K17904  type II thyroxine 5'-deiodinase [EC:1.21.99.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Drug target
Propylthiouracil: D00562<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    1734 (DIO2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.99  With unknown physiological acceptors
    1.21.99.4  thyroxine 5'-deiodinase
     1734 (DIO2)
SSDB
Motif
Pfam: T4_deiodinase AhpC-TSA Redoxin DUF2284
Other DBs
NCBI-GeneID: 1734
NCBI-ProteinID: NP_054644
OMIM: 601413
HGNC: 2884
Ensembl: ENSG00000211448
Pharos: Q92813(Tbio)
UniProt: Q92813
LinkDB
Position
14:complement(80197526..80231057)
AA seq 273 aa
MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGL
RCVWKSFLLDAYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASP
ERPLVVNFGSATUPPFTSQLPAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSF
EVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAY
LGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggcatcctcagcgtagacttgctgatcacactgcaaattctgccagtttttttctcc
aactgcctcttcctggctctctatgactcggtcattctgctcaagcacgtggtgctgctg
ttgagccgctccaagtccactcgcggagagtggcggcgcatgctgacctcagagggactg
cgctgcgtctggaagagcttcctcctcgatgcctacaaacaggtgaaattgggtgaggat
gcccccaattccagtgtggtgcatgtctccagtacagaaggaggtgacaacagtggcaat
ggtacccaggagaagatagctgagggagccacatgccaccttcttgactttgccagccct
gagcgcccactagtggtcaactttggctcagccacttgacctcctttcacgagccagctg
ccagccttccgcaaactggtggaagagttctcctcagtggctgacttcctgctggtctac
attgatgaggctcatccatcagatggctgggcgataccgggggactcctctttgtctttt
gaggtgaagaagcaccagaaccaggaagatcgatgtgcagcagcccagcagcttctggag
cgtttctccttgccgccccagtgccgagttgtggctgaccgcatggacaataacgccaac
atagcttacggggtagcctttgaacgtgtgtgcattgtgcagagacagaaaattgcttat
ctgggaggaaagggccccttctcctacaaccttcaagaagtccggcattggctggagaag
aatttcagcaagagatgaaagaaaactagattagctggttaa

DBGET integrated database retrieval system