KEGG   Homo sapiens (human): 1837
Entry
1837              CDS       T01001                                 
Symbol
DTNA, D18S892E, DRP3, DTN, DTN-A, LVNC1
Name
(RefSeq) dystrobrevin alpha
  KO
K26998  dystrobrevin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
hsa05416  Viral myocarditis
Network
nt06539  Cytoskeleton in muscle cells
  Element
N00465  Deleted DMD to dystrophin-associated protein complex
N01816  Costamere
Disease
H01216  Left ventricular noncompaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    1837 (DTNA)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    1837 (DTNA)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    1837 (DTNA)
   05414 Dilated cardiomyopathy
    1837 (DTNA)
   05416 Viral myocarditis
    1837 (DTNA)
SSDB
Motif
Pfam: EF-hand_2 EF-hand_3 ZZ SOGA Seryl_tRNA_N IATP FapA
Other DBs
NCBI-GeneID: 1837
NCBI-ProteinID: NP_001381
OMIM: 601239
HGNC: 3057
Ensembl: ENSG00000134769
UniProt: Q9Y4J8
Structure
LinkDB
Position
18:34493312..34891844
AA seq 743 aa
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
ALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFD
PEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTA
VFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHP
VECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLT
NALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVDTWPPRPVTSMNDTLFSHSVPSSGSP
FITRSSPPKDSEVEQNKLLARAAPAFLKGKGIQYSLNVADRLADEHVLIGLYVNMLRNNP
SCMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIAELE
NKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRR
ELMVQLEGLMKLLKTQGAGSPRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGVGGD
VQEAFAQSSRRNLRNDLLVAADSITNTMSSLVKELNSEVGSETESNVDSEFARTQFEDLV
PSPTSEKAFLAQIHARKPGYIHSGATTSTMRGDMVTEDADPYVQPEDENYENDSVRQLEN
ELQMEEYLKQKLQDEAYQVSLQG
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgattgaagatagtgggaaaagaggaaataccatggcagaaagaagacagctgtttgca
gagatgagggctcaagatctggatcgcatccgactctccacctacagaacagcatgcaag
cttaggtttgttcagaagaaatgcaatttgcacctggtggacatatggaatgtcatagaa
gcattgcgggaaaatgctctgaacaacctggacccaaacactgaactcaacgtgtcccgc
ttagaggctgtgctctccactattttttaccagctcaacaaacggatgccaaccactcac
caaatccatgtggagcagtccatcagcctcctccttaacttcctgcttgcagcgtttgat
ccggaaggccatggtaaaatttcagtatttgctgtcaaaatggctttagccacattgtgt
ggagggaagatcatggacaaattaagatatattttctcaatgatttctgactccagtggg
gtgatggtttatggacgatatgaccaattccttcgggaagttctcaaactacccacggca
gtttttgaaggtccttcatttggttacacagaacagtcagccagatcctgtttctcccaa
cagaaaaaagtcacgttaaatggtttcttggacacgcttatgtcagatcctcccccgcag
tgtctggtctggttgcctcttctgcatcgactagcaaatgtggaaaatgtcttccatccg
gttgagtgttcctactgccacagtgagagtatgatgggatttcgctaccgatgccaacag
tgtcacaattaccagctctgtcaggactgcttctggaggggacatgccggtggttctcat
agcaaccagcaccaaatgaaagagtacacgtcatggaaatcacctgctaagaagctgact
aatgcattaagcaagtccctgagctgtgcttccagccgtgaacctttgcaccccatgttc
ccagatcagcctgagaagccactcaacttggctcacatcgttgatacttggcctcccaga
cctgtaaccagcatgaacgacaccctgttctcccactctgttccctcctcaggaagtcct
tttattaccaggagctctcctcccaaggacagtgaagtagagcagaacaaactgctggct
agggctgctccagcttttctgaagggcaaagggatacagtacagcctgaatgtggcagac
aggctagctgatgaacatgttctcatcgggttgtatgtcaacatgctccggaacaacccc
tcatgcatgcttgagagttcaaaccggcttgatgaagaacacaggctaattgccaggtat
gcggcaaggctggcagcagagtcctcttcgtctcagccacctcagcagagaagtgctcct
gacatctctttcaccatcgatgcgaataagcagcaaaggcagctgattgctgagctagaa
aacaagaacagagaaatcttacaggagatccagagacttcggctagagcatgaacaagct
tctcagcccacgccagagaaggcacagcaaaaccccaccctgctggcagaactccggctc
ctcagacagcgcaaagatgagctggaacagagaatgtctgctctccaggagagccggaga
gagctaatggtccagttggagggtctcatgaagctactaaagactcagggggcaggctct
ccccgctcctcccccagccacaccatcagcaggccaattcccatgcccatccggtcagcg
tcagcctgctccaccccgacgcacacgccgcaggactccctcacaggagtagggggagat
gtacaagaggcatttgcacaaagttcaagaagaaacttaaggaatgacttgctagtggct
gcagattccatcactaacactatgtcctctcttgtgaaagagctgaattctgaggttggg
agtgaaacagagagtaatgtggattctgaatttgcacggactcagtttgaggatcttgtt
ccctcaccaacctctgaaaaggcttttctagcgcaaatccatgcccgaaaacctgggtac
attcacagtggagctaccacaagtaccatgcgtggcgacatggttacggaggatgcagat
ccctatgtgcagcctgaagatgaaaactatgaaaatgactctgtccggcagctggagaat
gagctccagatggaggaatacctgaaacagaagctgcaagatgaagcttatcaggtcagc
ttgcaaggttga

DBGET integrated database retrieval system