KEGG   Homo sapiens (human): 201633
Entry
201633            CDS       T01001                                 
Symbol
TIGIT, VSIG9, VSTM3, WUCAM
Name
(RefSeq) T cell immunoreceptor with Ig and ITIM domains
  KO
K16350  T-cell immunoreceptor with Ig and ITIM domains
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Drug target
Belrestotug: D12348
Domvanalimab: D12367
Etigilimab: D11593
Ociperlimab: D12283
Tiragolumab: D11482
Vibostolimab: D11795
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    201633 (TIGIT)
SSDB
Motif
Pfam: V-set ig Ig_3 Ig_2 I-set
Other DBs
NCBI-GeneID: 201633
NCBI-ProteinID: NP_776160
OMIM: 612859
HGNC: 26838
Ensembl: ENSG00000181847
Pharos: Q495A1(Tbio)
UniProt: Q495A1
Structure
LinkDB
Position
3:114294028..114310288
AA seq 244 aa
MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWE
QQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTG
RIFLEVLESSVAEHGARFQIPLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLR
RKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFF
TETG
NT seq 735 nt   +upstreamnt  +downstreamnt
atgcgctggtgtctcctcctgatctgggcccaggggctgaggcaggctcccctcgcctca
ggaatgatgacaggcacaatagaaacaacggggaacatttctgcagagaaaggtggctct
atcatcttacaatgtcacctctcctccaccacggcacaagtgacccaggtcaactgggag
cagcaggaccagcttctggccatttgtaatgctgacttggggtggcacatctccccatcc
ttcaaggatcgagtggccccaggtcccggcctgggcctcaccctccagtcgctgaccgtg
aacgatacaggggagtacttctgcatctatcacacctaccctgatgggacgtacactggg
agaatcttcctggaggtcctagaaagctcagtggctgagcacggtgccaggttccagatt
ccattgcttggagccatggccgcgacgctggtggtcatctgcacagcagtcatcgtggtg
gtcgcgttgactagaaagaagaaagccctcagaatccattctgtggaaggtgacctcagg
agaaaatcagctggacaggaggaatggagccccagtgctccctcacccccaggaagctgt
gtccaggcagaagctgcacctgctgggctctgtggagagcagcggggagaggactgtgcc
gagctgcatgactacttcaatgtcctgagttacagaagcctgggtaactgcagcttcttc
acagagactggttag

DBGET integrated database retrieval system