KEGG   Homo sapiens (human): 2162
Entry
2162              CDS       T01001                                 
Symbol
F13A1, F13A
Name
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05171  Coronavirus disease - COVID-19
Disease
H00945  Factor XIII deficiency
H01730  Myocardial infarction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2162 (F13A1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    2162 (F13A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     2162 (F13A1)
SSDB
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Other DBs
NCBI-GeneID: 2162
NCBI-ProteinID: NP_000120
OMIM: 134570
HGNC: 3531
Ensembl: ENSG00000124491
Vega: OTTHUMG00000014186
Pharos: P00488(Tchem)
UniProt: P00488
Structure
LinkDB
Position
6:complement(6144084..6320662)
AA seq 732 aa
MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETD
TYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCL
YVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITD
TYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITF
RNNSHNRYTITAYLSANITFYTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLL
EQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVEFTNPLKET
LRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVYG
ELDVQIQRRPSM
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtcagaaacttccaggaccgcctttggaggcagaagagcagttccacccaataactct
aatgcagcggaagatgacctgcccacagtggagcttcagggcgtggtgccccggggcgtc
aacctgcaagagtttcttaatgtcacgagcgttcacctgttcaaggagagatgggacact
aacaaggtggaccaccacactgacaagtatgaaaacaacaagctgattgtccgcagaggg
cagtctttctatgtgcagattgacttcagtcgtccatatgaccccagaagggatctcttc
agggtggaatacgtcattggtcgctacccacaggagaacaagggaacctacatcccagtg
cctatagtctcagagttacaaagtggaaagtggggggccaagattgtcatgagagaggac
aggtctgtgcggctgtccatccagtcttcccccaaatgtattgtggggaaattccgcatg
tatgttgctgtctggactccctatggcgtacttcgaaccagtcgaaacccagaaacagac
acgtacattctcttcaatccttggtgtgaagatgatgctgtgtatctggacaatgagaaa
gaaagagaagagtatgtcctgaatgacatcggggtaattttttatggagaggtcaatgac
atcaagaccagaagctggagctatggtcagtttgaagatggcatcctggacacttgcctg
tatgtgatggacagagcacaaatggacctctctggaagagggaatcccatcaaagtcagc
cgtgtggggtctgcaatggtgaatgccaaagatgacgaaggtgtcctcgttggatcctgg
gacaatatctatgcctatggcgtccccccatcggcctggactggaagcgttgacattcta
ttggaataccggagctctgagaatccagtccggtatggccaatgctgggtttttgctggt
gtctttaacacatttttacgatgccttggaataccagcaagaattgttaccaattatttc
tctgcccatgataatgatgccaatttgcaaatggacatcttcctggaagaagatgggaac
gtgaattccaaactcaccaaggattcagtgtggaactaccactgctggaatgaagcatgg
atgacaaggcctgaccttcctgttggatttggaggctggcaagctgtggacagcaccccc
caggaaaatagcgatggcatgtatcggtgtggccccgcctcggttcaagccatcaagcac
ggccatgtctgcttccaatttgatgcaccttttgtttttgcagaggtcaacagcgacctc
atttacattacagctaagaaagatggcactcatgtggtggaaaatgtggatgccacccac
attgggaaattaattgtgaccaaacaaattggaggagatggcatgatggatattactgat
acttacaaattccaagaaggtcaagaagaagagagattggccctagaaactgccctgatg
tacggagctaaaaagcccctcaacacagaaggtgtcatgaaatcaaggtccaacgttgac
atggactttgaagtggaaaatgctgtgctgggaaaagacttcaagctctccatcaccttc
cggaacaacagccacaaccgttacaccatcacagcttatctctcagccaacatcaccttc
tacaccggggtcccgaaggcagaattcaagaaggagacgttcgacgtgacgctggagccc
ttgtccttcaagaaagaggcggtgctgatccaagccggcgagtacatgggtcagctgctg
gaacaagcgtccctgcacttctttgtcacagctcgcatcaatgagaccagggatgttctg
gccaagcaaaagtccaccgtgctaaccatccctgagatcatcatcaaggtccgtggcact
caggtagttggttctgacatgactgtgacagttgagtttaccaatcctttaaaagaaacc
ctgcgaaatgtctgggtacacctggatggtcctggagtaacaagaccaatgaagaagatg
ttccgtgaaatccggcccaactccaccgtgcagtgggaagaagtgtgccggccctgggtc
tctgggcatcggaagctgatagccagcatgagcagtgactccctgagacatgtgtatggc
gagctggacgtgcagattcaaagacgaccttccatgtga

KEGG   Homo sapiens (human): 2165
Entry
2165              CDS       T01001                                 
Symbol
F13B, FXIIIB
Name
(RefSeq) coagulation factor XIII B chain
  KO
K03906  coagulation factor XIII B polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05171  Coronavirus disease - COVID-19
Disease
H00945  Factor XIII deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2165 (F13B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    2165 (F13B)
SSDB
Motif
Pfam: Sushi Sushi_2
Other DBs
NCBI-GeneID: 2165
NCBI-ProteinID: NP_001985
OMIM: 134580
HGNC: 3534
Ensembl: ENSG00000143278
Vega: OTTHUMG00000036519
Pharos: P05160(Tbio)
UniProt: P05160
LinkDB
Position
1:complement(197038741..197067260)
AA seq 661 aa
MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCL
AGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCAS
GYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYEC
ATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVVQFF
CHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHI
ECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKV
TYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGILASYATGSS
VEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGD
LIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTV
DTYENGSSVEYRCFDHHFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDF
DNRPHILHGEYIEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQSTLSYQEPLR
T
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaggttgaaaaacctgacttttatcatcatattgataatctcaggagaactctatgca
gaagagaaaccctgtggttttcctcatgtggaaaatggaagaattgcccaatattactat
acttttaaaagcttttactttccaatgagcatagacaaaaaattgtcatttttctgcttg
gctggttataccactgaaagtggaagacaagaagagcaaaccacgtgtacaacagaaggc
tggtctccagagccaaggtgcttcaaaaaatgcactaagcctgacctgagtaatggttac
atctctgatgtaaagttattgtataaaattcaagagaacatgcgttatggttgcgcttca
gggtacaaaaccactggagggaaggatgaagaagtggttcaatgtctctctgatggatgg
tcttctcaaccaacctgtaggaaagaacatgaaacatgtttggctcctgaattatataat
ggaaattattccacaacacagaaaacattcaaagtgaaggacaaagtacaatacgaatgt
gctactggctactacacagctggaggaaagaagacagaggaggtagaatgtctcacatac
ggatggtctctcacaccaaaatgtaccaaattaaagtgctcttctttaagattaattgaa
aatggttattttcatcctgtaaagcaaacctatgaagaaggagatgtcgttcagtttttc
tgtcatgaaaattattatctaagtggatctgatttaattcaatgctataactttggttgg
tacccagaatctcctgtatgcgaaggaagaagaaacagatgtcctcctccacctctgccc
ataaactccaaaattcaaacacattcaacaacttatcgtcatggagaaatagttcatata
gaatgtgaacttaattttgagatccatgggtcagcagaaatacgttgtgaagatggaaaa
tggacagaacctccaaaatgcattgaaggacaggagaaggtagcctgtgaggaaccaccc
ttcattgaaaatggtgcagcaaatttacactctaagatttattacaatggggataaagtg
acatatgcatgtaaaagcggctaccttctccatggatcgaatgagataacttgtaatcgt
ggaaaatggacacttcctcctgagtgtgttgaaaataatgagaattgtaagcatcctcct
gttgtaatgaatggggctgttgcagacgggatattggcaagctatgcaacaggatcctca
gtggaatatagatgcaatgaatattacttactgaggggatcaaaaatatctcgttgcgaa
caaggaaaatggtcatccccacctgtttgcttggaaccatgtactgttaatgtggattac
atgaacagaaataacatagaaatgaagtggaaatatgaagggaaagtcttacatggagat
ttaatagattttgtatgtaaacagggatatgacttatctccattaaccccattgtctgaa
ttatctgtgcagtgcaacagaggagaagtgaaatatcctttatgtactagaaaagaatct
aaaggaatgtgcacatctcctcctcttattaaacatggagtcattattagttcaacagta
gacacctatgaaaatggctcttcagtagaatacagatgttttgatcaccatttcctagaa
ggatctagggaggcctattgtttagatggaatgtggactacaccaccattgtgtttagag
ccatgcacattatcttttactgaaatggaaaagaataatttacttctgaaatgggatttt
gacaatagaccacacattttgcatggtgaatatattgagtttatttgtagaggagatact
tatccagctgaattatatattactggatctatacttagaatgcaatgtgacagagggcag
ttaaaatatccaagatgtattccaagacaaagcactctgtcttatcaagaacccttaaga
acatag

DBGET integrated database retrieval system