KEGG   Homo sapiens (human): 2188
Entry
2188              CDS       T01001                                 
Symbol
FANCF, FAF
Name
(RefSeq) FA complementation group F
  KO
K10893  fanconi anemia group F protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    2188 (FANCF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2188 (FANCF)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     2188 (FANCF)
SSDB
Motif
Pfam: FANCF
Other DBs
NCBI-GeneID: 2188
NCBI-ProteinID: NP_073562
OMIM: 613897
HGNC: 3587
Ensembl: ENSG00000183161
Vega: OTTHUMG00000166070
Pharos: Q9NPI8(Tchem)
UniProt: Q9NPI8 A3KME0
Structure
LinkDB
Position
11:complement(22622533..22625823)
AA seq 374 aa
MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALER
RLHNQWRQEGGFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPG
VRDADEETLQESLARLARRRSAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKA
EAERPARFLSSLWERLPQNNFLKVIAVALLQPPLSRRPQEELEPGIHKSPGEGSQVLVHW
LLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQ
DVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFR
KRQVLGLSAGLSSV
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggaatcccttctgcagcacctggatcgcttttccgagcttctggcggtctcaagcact
acctacgtcagcacctgggaccccgccaccgtgcgccgggccttgcagtgggcgcgctac
ctgcgccacatccatcggcgctttggtcggcatggccccattcgcacggctctggagcgg
cggctgcacaaccagtggaggcaagagggcggctttgggcggggtccagttccgggatta
gcgaacttccaggccctcggtcactgtgacgtcctgctctctctgcgcctgctggagaac
cgggccctcggggatgcagctcgttaccacctggtgcagcaactctttcccggcccgggc
gtccgggacgccgatgaggagacactccaagagagcctggcccgccttgcccgccggcgg
tctgcggtgcacatgctgcgcttcaatggctatagagagaacccaaatctccaggaggac
tctctgatgaagacccaggcggagctgctgctggagcgtctgcaggaggtggggaaggcc
gaagcggagcgtcccgccaggtttctcagcagcctgtgggagcgcttgcctcagaacaac
ttcctgaaggtgatagcggtggcgctgttgcagccgcctttgtctcgtcggccccaagaa
gagttggaacccggcatccacaaatcacctggagaggggagccaagtgctagtccactgg
cttctggggaattcggaagtctttgctgccttttgtcgcgccctcccagccgggcttttg
actttagtgactagccgccacccagcgctgtctcctgtctatctgggtctgctaacagac
tggggtcaacgtttgcactatgaccttcagaaaggcatttgggttggaactgagtcccaa
gatgtgccctgggaggagttgcacaataggtttcaaagcctctgtcaggcccctccacct
ctgaaagataaagttctaactgccctggagacctgtaaagcgcaggatggagattttgaa
gtacctggtcttagcatctggacagacctcttattagctcttcgtagtggtgcatttagg
aaaagacaagttttgggtctcagcgcaggcctcagttctgtatag

DBGET integrated database retrieval system