KEGG   Homo sapiens (human): 2189
Entry
2189              CDS       T01001                                 
Symbol
FANCG, FAG, XRCC9
Name
(RefSeq) FA complementation group G
  KO
K10894  fanconi anemia group G protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    2189 (FANCG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2189 (FANCG)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     2189 (FANCG)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_1 TPR_12 TPR_7 TPR_14 TPR_19 Hpt
Other DBs
NCBI-GeneID: 2189
NCBI-ProteinID: NP_004620
OMIM: 602956
HGNC: 3588
Ensembl: ENSG00000221829
Vega: OTTHUMG00000019850
Pharos: O15287(Tbio)
UniProt: O15287 Q53XM5
Structure
LinkDB
Position
9:complement(35073839..35079942)
AA seq 622 aa
MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGL
PAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRE
LWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLL
LKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLC
PRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSAWGPPLLEASRLYQQLGDTTAEL
ESLELLVEALNVPCSSKAPQFLIEVELLLPPPDLASPLHCGTQSQTKHILASRCLQTGRA
GDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDALTLCEEL
LSRTSSLLPKMSRLWEDARKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFSRCL
ELLFRATPEEKEQGAAFNCEQGCKSDAALQQLRAAALISRGLEWVASGQDTKALQDFLLS
VQMCPGNRDTYFHLLQTLKRLDRRDEATALWWRLEAQTKGSHEDALWSLPLYLESYLSWI
RPSDRDAFLEEFRTSLPKSCDL
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgtcccgccagaccacctctgtgggctccagctgcctggacctgtggagggaaaagaat
gaccggctcgttcgacaggccaaggtggctcagaactccggtctgactctgaggcgacag
cagttggctcaggatgcactggaagggctcagagggctcctccatagtctgcaagggctc
cctgcagctgttcctgttcttcccttggagctgactgtcacctgcaacttcattatcctg
agggcaagcttggcccagggtttcacagaggatcaggcccaggatatccagcggagccta
gagagagtgctggagacacaggagcagcaggggcccaggttggaacaggggctcagggag
ctgtgggactctgtccttcgtgcttcctgccttctgccggagctgctgtctgccctgcac
cgcctggttggcctgcaggctgccctctggttgagtgctgaccgtcttggggacctggcc
ttgttactagagaccctgaatggcagccagagtggagcctctaaggatctgctgttactt
ctgaaaacttggagtcccccagctgaggaattagatgctccattgaccctgcaggatgcc
cagggattgaaggatgtcctcctgacagcatttgcctaccgccaaggtctccaggagctg
atcacagggaacccagacaaggcactaagcagccttcatgaagcggcctcaggcctgtgt
ccacggcctgtgttggtccaggtgtacacagcactggggtcctgtcaccgtaagatggga
aatccacagagagcactgttgtacttggttgcagccctgaaagagggatcagcctggggt
cctccacttctggaggcctctaggctctatcagcaactgggggacacaacagcagagctg
gagagtctggagctgctagttgaggccttgaatgtcccatgcagttccaaagccccgcag
tttctcattgaggtagaattactactgccaccacctgacctagcctcaccccttcattgt
ggcactcagagccagaccaagcacatactagcaagcaggtgcctacagacggggagggca
ggagacgctgcagagcattacttggacctgctggccctgttgctggatagctcggagcca
aggttctccccacccccctcccctccagggccctgtatgcctgaggtgtttttggaggca
gcggtagcactgatccaggcaggcagagcccaagatgccttgactctatgtgaggagttg
ctcagccgcacatcatctctgctacccaagatgtcccggctgtgggaagatgccagaaaa
ggaaccaaggaactgccatactgcccactctgggtctctgccacccacctgcttcagggc
caggcctgggttcaactgggtgcccaaaaagtggcaattagtgaatttagcaggtgcctc
gagctgctcttccgggccacacctgaggaaaaagaacaaggggcagctttcaactgtgag
cagggatgtaagtcagatgcggcactgcagcagcttcgggcagccgccctaattagtcgt
ggactggaatgggtagccagcggccaggataccaaagccttacaggacttcctcctcagt
gtgcagatgtgcccaggtaatcgagacacttactttcacctgcttcagactctgaagagg
ctagatcggagggatgaggccactgcactctggtggaggctggaggcccaaactaagggg
tcacatgaagatgctctgtggtctctccccctgtacctagaaagctatttgagctggatc
cgtccctctgatcgtgacgccttccttgaagaatttcggacatctctgccaaagtcttgt
gacctgtag

DBGET integrated database retrieval system