KEGG   Homo sapiens (human): 2197
Entry
2197              CDS       T01001                                 
Symbol
FAU, FAU1, Fub1, Fubi, MNSFbeta, RPS30, S30, asr1
Name
(RefSeq) FAU ubiquitin like and ribosomal protein S30 fusion
  KO
K02983  small subunit ribosomal protein S30e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
hsa05171  Coronavirus disease - COVID-19
Network
nt06141  Translation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01317  Translation initiation
N01318  SARS-CoV-2 nsp1 to translation initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    2197 (FAU)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    2197 (FAU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    2197 (FAU)
   04121 Ubiquitin system [BR:hsa04121]
    2197 (FAU)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    2197 (FAU)
  Archaea
    2197 (FAU)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   2197 (FAU)
SSDB
Motif
Pfam: Ribosomal_S30 ubiquitin Rad60-SLD TmoB Flavodoxin_NdrI
Other DBs
NCBI-GeneID: 2197
NCBI-ProteinID: NP_001988
OMIM: 134690
HGNC: 3597
Ensembl: ENSG00000149806
Pharos: P35544(Tbio)
UniProt: P62861
Structure
LinkDB
Position
11:complement(65120630..65122134)
AA seq 133 aa
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVE
ALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV
PTFGKKKGPNANS
NT seq 402 nt   +upstreamnt  +downstreamnt
atgcagctctttgtccgcgcccaggagctacacaccttcgaggtgaccggccaggaaacg
gtcgcccagatcaaggctcatgtagcctcactggagggcattgccccggaagatcaagtc
gtgctcctggcaggcgcgcccctggaggatgaggccactctgggccagtgcggggtggag
gccctgactaccctggaagtagcaggccgcatgcttggaggtaaagtccatggttccctg
gcccgtgctggaaaagtgagaggtcagactcctaaggtggccaaacaggagaagaagaag
aagaagacaggtcgggctaagcggcggatgcagtacaaccggcgctttgtcaacgttgtg
cccacctttggcaagaagaagggccccaatgccaactcttaa

DBGET integrated database retrieval system