KEGG   Homo sapiens (human): 22909
Entry
22909             CDS       T01001                                 

Gene name
FAN1, KIAA1018, KMIN, MTMR15, hFAN1
Definition
(RefSeq) FANCD2 and FANCI associated nuclease 1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Disease
H01877  Chromosome 15q13.3 microdeletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    22909 (FAN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    22909 (FAN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     22909 (FAN1)
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     22909 (FAN1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     22909 (FAN1)
SSDB
Motif
Pfam: VRR_NUC DUF4363 zf-TRAF zf-WRNIP1_ubi
Other DBs
NCBI-GeneID: 22909
NCBI-ProteinID: NP_055782
OMIM: 613534
HGNC: 29170
Ensembl: ENSG00000198690
Vega: OTTHUMG00000175661
Pharos: Q9Y2M0(Tbio)
UniProt: Q9Y2M0
LinkDB
Structure
PDB: 

Position
15q13.3
AA seq 1017 aa
MMSEGKPPDKKRPRRSLSISKNKKKASNSIISCFNNAPPAKLACPVCSKMVPRYDLNRHL
DEMCANNDFVQVDPGQVGLINSNVSMVDLTSVTLEDVTPKKSPPPKTNLTPGQSDSAKRE
VKQKISPYFKSNDVVCKNQDELRNRSVKVICLGSLASKLSRKYVKAKKSIDKDEEFAGSS
PQSSKSTVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRGSKIMEAE
SQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACH
CEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQG
SSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVR
LFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSL
AKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRAKALAGQSVRICKG
PRAVFSRILLLFSLTDSMEDEDAACGGQGQLSTVLLVNLGRMEFPSYTINRKTHIFQDRD
DLIRYAAATHMLSDISSAMANGNWEEAKELAQCAKRDWNRLKNHPSLRCHEDLPLFLRCF
TVGWIYTRILSRFVEILQRLHMYEEAVRELESLLSQRIYCPDSRGRWWDRLALNLHQHLK
RLEPTIKCITEGLADPEVRTGHRLSLYQRAVRLRESPSCKKFKHLFQQLPEMAVQDVKHV
TITGRLCPQRGMCKSVFVMEAGEAADPTTVLCSVEELALAHYRRSGFDQGIHGEGSTFST
LYGLLLWDIIFMDGIPDVFRNACQAFPLDLCTDSFFTSRRPALEARLQLIHDAPEESLRA
WVAATWHEQEGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPD
LVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVAVGAKSQSLS
NT seq 3054 nt   +upstreamnt  +downstreamnt
atgatgtcagaagggaaacctcctgacaaaaaaaggcctcgtagaagcttatcaatcagc
aagaataagaaaaaagcatctaattctattatttcgtgttttaacaatgcaccacctgct
aaacttgcctgccccgtttgcagtaaaatggtgcctagatatgacttaaaccggcacctt
gatgaaatgtgtgctaacaatgacttcgttcaagtggatccagggcaggttggcttaata
aattcaaatgtgtctatggtagatttaaccagtgttaccttagaagatgtaacacctaag
aagtcaccaccaccaaagacaaatttaacccctggccaaagtgattcagcaaaaagggaa
gtaaagcagaagatcagtccctactttaaaagtaatgatgtggtgtgcaaaaatcaagat
gagctgagaaatcgtagtgtgaaagtcatttgtttgggaagcctagcatctaaattgtcc
agaaaatacgtaaaggctaaaaaatcaatagataaggatgaagaatttgccggttctagt
ccacagagttccaaatccacagttgttaagagcctgattgataactcttcagaaattgag
gacgaggatcaaattttggagaacagttctcaaaaagaaaacgtgtttaaatgtgattct
ctaaaggaagagtgcattcctgaacatatggtaagaggaagtaaaataatggaagccgaa
agccaaaaggctacccgggaatgtgagaaatcagccctcacccctggattctcagataat
gcgatcatgttattctcaccagatttcactcttaggaatacattaaagtctacttcagaa
gacagtcttgtaaagcaagagtgtatcaaagaagtggttgaaaaacgtgaggcatgtcat
tgtgaagaagtaaaaatgactgttgcttcagaagctaaaatacagctgtcagattcagag
gcaaaatctcatagttctgcagatgatgcttctgcatggagtaacatccaagaggctcct
ctgcaggatgacagttgcttaaacaatgatatccctcacagcattcctttggagcagggg
tcaagctgcaatggtcctggtcaaacaaccggtcatccttactaccttcggagtttcctt
gtggtgctgaaaaccgtacttgagaatgaagatgatatgttgctctttgatgagcaggag
aagggaattgtaactaaattttatcagttatcagctactggtcagaagttatatgtaagg
ctctttcaacgtaaattaagctggattaagatgaccaaattagagtatgaagagattgcc
ttagacttaacacctgtgattgaagaattgacgaatgcaggctttctacagacagaatct
gagttgcaagaactctctgaagtgcttgaactcctttctgctcctgaactaaaatcccta
gccaagaccttccacttggtgaatcccaatggacagaaacagcagctggtggacgccttt
ctcaaattggccaaacagcgttcagtctgcacttggggcaagaataagcctggaattggt
gcagtgattttaaaaagagccaaagccttggctggacagtcagtacgaatctgtaaaggc
cccagggctgtgttttcccgcatcttgctactgttttcgttgaccgactcaatggaagat
gaagacgccgcttgtggaggtcagggacagctttcaacagtcctgttggtcaacctcggc
cgaatggagtttcctagttacaccatcaatcggaaaacccacatcttccaagacagagat
gatcttatcagatatgcagcagccacgcacatgctgagtgacatttcttccgcaatggcc
aatgggaactgggaagaagctaaggagctcgctcagtgtgcaaaaagggattggaacaga
ctgaaaaaccacccttctctgagatgccacgaagatttaccactcttcctgcggtgtttc
actgttgggtggatttatacaaggattttgtctcggtttgtggaaatactgcagagactt
cacatgtatgaggaagccgtcagagaacttgaaagccttttgtctcagagaatttattgt
cctgacagcagaggccgatggtgggatcgactggcccttaatttacaccagcacttgaag
cgcctggaaccgactatcaagtgcatcacagaggggctggcggatccggaagtcagaacg
ggacaccgcctttcactgtatcagcgagccgtgcgcctgcgagagtctccgagctgtaaa
aagttcaagcacctcttccagcagctcccagaaatggctgtgcaagatgtgaaacacgtg
accatcacaggcaggctgtgcccacagcgtgggatgtgcaagtctgtgtttgtgatggag
gccggggaggccgctgaccccaccacggtcctgtgctctgtggaggagctggcactggcc
cattacagacgcagcggttttgaccaggggattcatggcgaagggtccaccttcagcacc
ctgtatggcctcctcctgtgggacatcatcttcatggatgggattccggatgtcttcaga
aacgcctgtcaggcattccccctggacttgtgcacagacagcttcttcacaagcagacgc
ccagcccttgaggccaggctgcagctgattcatgatgcccccgaggagagcctgcgggcc
tgggtggcagccacgtggcatgagcaggaaggcagagtggcttcccttgtcagctgggat
cgcttcacgtctcttcagcaagctcaggatcttgtctcctgcctggggggccctgtgctc
agtggtgtgtgcaggcacctggctgctgactttcgacactgtcgagggggcctccccgac
ctggtggtgtggaactcccagagccgtcactttaagctggtggaagttaaaggccccaat
gatcgtctttcacataagcagatgatctggctggctgaactgcagaagctgggggctgaa
gtagaagtctgccatgtggttgcagttggagctaagagccaaagccttagctaa

DBGET integrated database retrieval system