KEGG   Homo sapiens (human): 22909
Entry
22909             CDS       T01001                                 
Symbol
FAN1, KIAA1018, KMIN, MTMR15, hFAN1
Name
(RefSeq) FANCD2 and FANCI associated nuclease 1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Network
nt06508  Interstrand crosslink repair
  Element
N01465  Lesion bypass by TLS and DSB formation
Disease
H01877  Chromosome 15q13.3 microdeletion syndrome
H02577  Karyomegalic interstitial nephritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    22909 (FAN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    22909 (FAN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     22909 (FAN1)
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-
     22909 (FAN1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     22909 (FAN1)
SSDB
Motif
Pfam: VRR_NUC DUF4363 zf-TRAF zf-WRNIP1_ubi
Other DBs
NCBI-GeneID: 22909
NCBI-ProteinID: NP_055782
OMIM: 613534
HGNC: 29170
Ensembl: ENSG00000198690
Pharos: Q9Y2M0(Tbio)
UniProt: Q9Y2M0
Structure
LinkDB
Position
15:30903852..30943108
AA seq 1017 aa
MMSEGKPPDKKRPRRSLSISKNKKKASNSIISCFNNAPPAKLACPVCSKMVPRYDLNRHL
DEMCANNDFVQVDPGQVGLINSNVSMVDLTSVTLEDVTPKKSPPPKTNLTPGQSDSAKRE
VKQKISPYFKSNDVVCKNQDELRNRSVKVICLGSLASKLSRKYVKAKKSIDKDEEFAGSS
PQSSKSTVVKSLIDNSSEIEDEDQILENSSQKENVFKCDSLKEECIPEHMVRGSKIMEAE
SQKATRECEKSALTPGFSDNAIMLFSPDFTLRNTLKSTSEDSLVKQECIKEVVEKREACH
CEEVKMTVASEAKIQLSDSEAKSHSSADDASAWSNIQEAPLQDDSCLNNDIPHSIPLEQG
SSCNGPGQTTGHPYYLRSFLVVLKTVLENEDDMLLFDEQEKGIVTKFYQLSATGQKLYVR
LFQRKLSWIKMTKLEYEEIALDLTPVIEELTNAGFLQTESELQELSEVLELLSAPELKSL
AKTFHLVNPNGQKQQLVDAFLKLAKQRSVCTWGKNKPGIGAVILKRAKALAGQSVRICKG
PRAVFSRILLLFSLTDSMEDEDAACGGQGQLSTVLLVNLGRMEFPSYTINRKTHIFQDRD
DLIRYAAATHMLSDISSAMANGNWEEAKELAQCAKRDWNRLKNHPSLRCHEDLPLFLRCF
TVGWIYTRILSRFVEILQRLHMYEEAVRELESLLSQRIYCPDSRGRWWDRLALNLHQHLK
RLEPTIKCITEGLADPEVRTGHRLSLYQRAVRLRESPSCKKFKHLFQQLPEMAVQDVKHV
TITGRLCPQRGMCKSVFVMEAGEAADPTTVLCSVEELALAHYRRSGFDQGIHGEGSTFST
LYGLLLWDIIFMDGIPDVFRNACQAFPLDLCTDSFFTSRRPALEARLQLIHDAPEESLRA
WVAATWHEQEGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPD
LVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVAVGAKSQSLS
NT seq 3054 nt   +upstreamnt  +downstreamnt
atgatgtcagaagggaaacctcctgacaaaaaaaggcctcgtagaagcttatcaatcagc
aagaataagaaaaaagcatctaattctattatttcgtgttttaacaatgcaccacctgct
aaacttgcctgccccgtttgcagtaaaatggtgcctagatatgacttaaaccggcacctt
gatgaaatgtgtgctaacaatgacttcgttcaagtggatccagggcaggttggcttaata
aattcaaatgtgtctatggtagatttaaccagtgttaccttagaagatgtaacacctaag
aagtcaccaccaccaaagacaaatttaacccctggccaaagtgattcagcaaaaagggaa
gtaaagcagaagatcagtccctactttaaaagtaatgatgtggtgtgcaaaaatcaagat
gagctgagaaatcgtagtgtgaaagtcatttgtttgggaagcctagcatctaaattgtcc
agaaaatacgtaaaggctaaaaaatcaatagataaggatgaagaatttgccggttctagt
ccacagagttccaaatccacagttgttaagagcctgattgataactcttcagaaattgag
gacgaggatcaaattttggagaacagttctcaaaaagaaaacgtgtttaaatgtgattct
ctaaaggaagagtgcattcctgaacatatggtaagaggaagtaaaataatggaagccgaa
agccaaaaggctacccgggaatgtgagaaatcagccctcacccctggattctcagataat
gcgatcatgttattctcaccagatttcactcttaggaatacattaaagtctacttcagaa
gacagtcttgtaaagcaagagtgtatcaaagaagtggttgaaaaacgtgaggcatgtcat
tgtgaagaagtaaaaatgactgttgcttcagaagctaaaatacagctgtcagattcagag
gcaaaatctcatagttctgcagatgatgcttctgcatggagtaacatccaagaggctcct
ctgcaggatgacagttgcttaaacaatgatatccctcacagcattcctttggagcagggg
tcaagctgcaatggtcctggtcaaacaaccggtcatccttactaccttcggagtttcctt
gtggtgctgaaaaccgtacttgagaatgaagatgatatgttgctctttgatgagcaggag
aagggaattgtaactaaattttatcagttatcagctactggtcagaagttatatgtaagg
ctctttcaacgtaaattaagctggattaagatgaccaaattagagtatgaagagattgcc
ttagacttaacacctgtgattgaagaattgacgaatgcaggctttctacagacagaatct
gagttgcaagaactctctgaagtgcttgaactcctttctgctcctgaactaaaatcccta
gccaagaccttccacttggtgaatcccaatggacagaaacagcagctggtggacgccttt
ctcaaattggccaaacagcgttcagtctgcacttggggcaagaataagcctggaattggt
gcagtgattttaaaaagagccaaagccttggctggacagtcagtacgaatctgtaaaggc
cccagggctgtgttttcccgcatcttgctactgttttcgttgaccgactcaatggaagat
gaagacgccgcttgtggaggtcagggacagctttcaacagtcctgttggtcaacctcggc
cgaatggagtttcctagttacaccatcaatcggaaaacccacatcttccaagacagagat
gatcttatcagatatgcagcagccacgcacatgctgagtgacatttcttccgcaatggcc
aatgggaactgggaagaagctaaggagctcgctcagtgtgcaaaaagggattggaacaga
ctgaaaaaccacccttctctgagatgccacgaagatttaccactcttcctgcggtgtttc
actgttgggtggatttatacaaggattttgtctcggtttgtggaaatactgcagagactt
cacatgtatgaggaagccgtcagagaacttgaaagccttttgtctcagagaatttattgt
cctgacagcagaggccgatggtgggatcgactggcccttaatttacaccagcacttgaag
cgcctggaaccgactatcaagtgcatcacagaggggctggcggatccggaagtcagaacg
ggacaccgcctttcactgtatcagcgagccgtgcgcctgcgagagtctccgagctgtaaa
aagttcaagcacctcttccagcagctcccagaaatggctgtgcaagatgtgaaacacgtg
accatcacaggcaggctgtgcccacagcgtgggatgtgcaagtctgtgtttgtgatggag
gccggggaggccgctgaccccaccacggtcctgtgctctgtggaggagctggcactggcc
cattacagacgcagcggttttgaccaggggattcatggcgaagggtccaccttcagcacc
ctgtatggcctcctcctgtgggacatcatcttcatggatgggattccggatgtcttcaga
aacgcctgtcaggcattccccctggacttgtgcacagacagcttcttcacaagcagacgc
ccagcccttgaggccaggctgcagctgattcatgatgcccccgaggagagcctgcgggcc
tgggtggcagccacgtggcatgagcaggaaggcagagtggcttcccttgtcagctgggat
cgcttcacgtctcttcagcaagctcaggatcttgtctcctgcctggggggccctgtgctc
agtggtgtgtgcaggcacctggctgctgactttcgacactgtcgagggggcctccccgac
ctggtggtgtggaactcccagagccgtcactttaagctggtggaagttaaaggccccaat
gatcgtctttcacataagcagatgatctggctggctgaactgcagaagctgggggctgaa
gtagaagtctgccatgtggttgcagttggagctaagagccaaagccttagctaa

DBGET integrated database retrieval system