KEGG   Homo sapiens (human): 23047
Entry
23047             CDS       T01001                                 
Symbol
PDS5B, APRIN, AS3, CG008
Name
(RefSeq) PDS5 cohesin associated factor B
  KO
K11267  sister chromatid cohesion protein PDS5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Network
nt06512  Chromosome cohesion and segregation
  Element
N01484  Establishment of cohesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    23047 (PDS5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23047 (PDS5B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    23047 (PDS5B)
SSDB
Motif
Pfam: PDS5 PI-TkoII_IV DUF4420
Other DBs
NCBI-GeneID: 23047
NCBI-ProteinID: NP_055847
OMIM: 605333
HGNC: 20418
Ensembl: ENSG00000083642
UniProt: Q9NTI5
Structure
LinkDB
Position
13:32586452..32778019
AA seq 1447 aa
MAHSKTRTNDGKITYPPGVKEISDKISKEEMVRRLKMVVKTFMDMDQDSEEEKELYLNLA
LHLASDFFLKHPDKDVRLLVACCLADIFRIYAPEAPYTSPDKLKDIFMFITRQLKGLEDT
KSPQFNRYFYLLENIAWVKSYNICFELEDSNEIFTQLYRTLFSVINNGHNQKVHMHMVDL
MSSIICEGDTVSQELLDTVLVNLVPAHKNLNKQAYDLAKALLKRTAQAIEPYITNFFNQV
LMLGKTSISDLSEHVFDLILELYNIDSHLLLSVLPQLEFKLKSNDNEERLQVVKLLAKMF
GAKDSELASQNKPLWQCYLGRFNDIHVPIRLECVKFASHCLMNHPDLAKDLTEYLKVRSH
DPEEAIRHDVIVSIVTAAKKDILLVNDHLLNFVRERTLDKRWRVRKEAMMGLAQIYKKYA
LQSAAGKDAAKQIAWIKDKLLHIYYQNSIDDRLLVERIFAQYMVPHNLETTERMKCLYYL
YATLDLNAVKALNEMWKCQNLLRHQVKDLLDLIKQPKTDASVKAIFSKVMVITRNLPDPG
KAQDFMKKFTQVLEDDEKIRKQLEVLVSPTCSCKQAEGCVREITKKLGNPKQPTNPFLEM
IKFLLERIAPVHIDTESISALIKQVNKSIDGTADDEDEGVPTDQAIRAGLELLKVLSFTH
PISFHSAETFESLLACLKMDDEKVAEAALQIFKNTGSKIEEDFPHIRSALLPVLHHKSKK
GPPRQAKYAIHCIHAIFSSKETQFAQIFEPLHKSLDPSNLEHLITPLVTIGHIALLAPDQ
FAAPLKSLVATFIVKDLLMNDRLPGKKTTKLWVPDEEVSPETMVKIQAIKMMVRWLLGMK
NNHSKSGTSTLRLLTTILHSDGDLTEQGKISKPDMSRLRLAAGSAIVKLAQEPCYHEIIT
LEQYQLCALAINDECYQVRQVFAQKLHKGLSRLRLPLEYMAICALCAKDPVKERRAHARQ
CLVKNINVRREYLKQHAAVSEKLLSLLPEYVVPYTIHLLAHDPDYVKVQDIEQLKDVKEC
LWFVLEILMAKNENNSHAFIRKMVENIKQTKDAQGPDDAKMNEKLYTVCDVAMNIIMSKS
TTYSLESPKDPVLPARFFTQPDKNFSNTKNYLPPEMKSFFTPGKPKTTNVLGAVNKPLSS
AGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDK
RDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESD
EQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSG
PPAPEEEEEEERQSGNTEQKSKSKQHRVSRRAQQRAESPESSAIESTQSTPQKGRGRPSK
TPSPSQPKKNVRVGRSKQAATKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRR
SAKRERR
NT seq 4344 nt   +upstreamnt  +downstreamnt
atggctcattcaaagactaggaccaatgatggaaaaattacatatccgcctggggtcaag
gaaatatcagataaaatatctaaagaggagatggtgagacgattaaagatggttgtgaaa
acttttatggatatggaccaggactctgaagaagaaaaggagctttatttaaacctagct
ttacatcttgcttcagatttttttctcaagcatcctgataaagatgttcgcttactggta
gcctgctgccttgctgatattttcaggatttatgctcctgaagctccttacacatcccct
gataaactaaaggatatatttatgtttataacaagacagttgaaggggctagaggataca
aagagcccacaattcaataggtatttttatttacttgagaacattgcttgggtcaagtca
tataacatatgctttgagttagaagatagcaatgaaattttcacccagctatacagaacc
ttattttcagttataaacaatggccacaatcagaaagtccatatgcacatggtagacctt
atgagctctattatttgtgaaggtgatacagtgtctcaggagcttttggatacggtttta
gtaaatctggtacctgctcataagaatttaaacaagcaagcatatgatttggcaaaggct
ttactgaagaggacagctcaagctattgagccatatattaccaatttttttaatcaggtt
ctgatgcttgggaaaacatctatcagcgatttgtcagagcatgtctttgacttaattttg
gagctctacaatattgatagtcatttgctgctctctgttttaccccagcttgaatttaaa
ttaaagagcaatgataatgaggagcgcctacaagttgttaaactactggcaaaaatgttt
ggggcaaaggattcagaattggcttctcaaaacaagccactttggcagtgctacttgggc
aggtttaatgatatccatgtaccaatccgcctggaatgtgtgaaatttgctagccattgt
ctcatgaaccatcctgatttagcaaaagacttaacagagtatcttaaagtgaggtcacat
gaccctgaggaagctattagacatgatgttattgtgtcaatagttacagctgctaaaaag
gatattcttctggtcaatgatcacttacttaattttgtgagagagagaacattagacaaa
cgatggagagtacgcaaagaagccatgatgggacttgcccaaatttataagaaatatgct
ttacagtcagcagctggaaaagatgctgcaaaacagatagcatggatcaaagacaaattg
ctacatatatattatcaaaatagtattgatgatcgactacttgttgaacggatctttgct
caatacatggttcctcacaatttagaaactacagaacggatgaaatgcttatattacttg
tatgccacactggatttaaatgctgtgaaagcattgaatgaaatgtggaaatgtcaaaat
ctgctccgacatcaagtaaaggatttgcttgacttgattaagcaacccaaaacagatgcc
agtgtcaaggccatattttcaaaagtgatggttattacaagaaatttacctgatcctggt
aaggctcaggatttcatgaagaaattcacacaggtgttagaagatgatgagaaaataaga
aagcagttagaagtacttgttagtccaacatgctcctgcaagcaggctgaaggttgtgtg
cgtgaaataactaagaagttgggcaaccccaaacagcctacaaatcctttcctggaaatg
atcaagtttctcttggagaggatagcacctgtgcacatagataccgaatctatcagtgct
cttattaaacaagtgaacaaatcaatagatggaacagcagatgatgaagatgagggtgtt
ccaactgatcaagccatcagagcaggtcttgaactgcttaaggtactctcatttacacat
cccatctcatttcattctgctgaaacatttgaatcattactggcttgtctgaaaatggat
gatgaaaaagtagcagaagctgcactacaaattttcaaaaacacaggaagcaaaattgaa
gaggattttccacacatcagatcagccttgcttcctgttttacatcacaaatctaaaaaa
ggacccccccgtcaagccaaatatgccattcattgtatccatgcgatattttctagtaaa
gagacccagtttgcacagatatttgagcctctgcataagagcctagatccaagcaacctg
gaacatctcataacaccattggttactattggtcatattgctctccttgcacctgatcaa
tttgctgctcctttgaaatctttggtagctactttcattgtgaaagatcttctcatgaat
gatcggcttccagggaaaaagacaactaaactttgggttccagatgaagaagtatctcct
gagacaatggtcaaaattcaggctattaaaatgatggttcgatggctacttggaatgaaa
aataatcacagtaaatcaggaacttctaccttaagattgctaacaacaatattgcatagt
gatggagacttgacagaacaggggaaaattagtaaaccagatatgtcacgtctgagactt
gctgctgggagtgctattgtgaagctggcacaagaaccctgttaccatgaaatcatcaca
ttagaacaatatcagctatgtgcattagctatcaacgatgaatgctatcaagtaagacaa
gtgtttgcccagaaacttcacaaaggcctttcccgtttacggcttccacttgagtatatg
gcaatctgtgccctttgtgcaaaagatcctgtaaaggagagaagagctcatgctaggcaa
tgtttggtgaaaaatataaatgtaaggcgggagtatctgaagcagcatgcagctgttagt
gaaaaattattgtctcttctaccagagtatgttgttccatatacaattcaccttttggca
catgacccagattatgtcaaagtacaggatattgaacaacttaaagatgttaaagaatgt
ctttggtttgttctggaaatattaatggctaaaaatgaaaataacagtcacgcttttatc
agaaagatggtagaaaatattaaacaaacaaaagatgcccaaggaccagatgatgcaaaa
atgaatgaaaaactgtacactgtgtgtgatgttgccatgaatatcatcatgtcaaagagt
actacatacagtttggaatctcctaaagacccggtactaccagctcgtttcttcactcaa
cctgacaagaatttcagtaacaccaaaaattatctgcctcctgaaatgaaatcatttttc
actcctggaaaacctaaaacaaccaatgttctaggagctgttaacaagccactttcatca
gcaggcaagcaatctcagaccaaatcatcacgaatggaaactgtaagcaatgcaagcagc
agctcaaatccaagctctcctggaagaataaaggggaggcttgatagttctgaaatggat
cacagtgaaaatgaagattacacaatgtcttcacctttgccggggaaaaaaagtgacaag
agagacgactctgatcttgtaaggtctgaattggagaagcctagaggcaggaaaaaaacg
cccgtcacagaacaggaggagaaattaggtatggatgacttgactaagttggtacaggaa
cagaaacctaaaggcagtcagcgaagtcggaaaagaggccatacggcttcagaatctgat
gaacagcagtggcctgaggaaaagaggctcaaagaagatatattagaaaatgaagatgaa
cagaatagtccgccaaaaaagggtaaaagaggccgaccaccaaaacctcttggtggaggt
acaccaaaagaagagccaacaatgaaaacttctaaaaaaggaagcaaaaaaaaatctgga
cctccagcaccagaggaggaggaagaagaagaaagacaaagtggaaatacggaacagaag
tccaaaagcaaacagcaccgagtgtcaaggagagcacagcagagagcagaatctcctgaa
tctagtgcaattgaatccacacagtccacaccacagaaaggacgaggaagaccatcaaaa
acgccatcaccatcacaaccaaaaaaaaatgtccgtgtaggacgctccaaacaagcagct
actaaggaaaatgattcaagtgaagaagtagatgtgtttcagggtagctctcctgtcgat
gatattccacaggaagaaacagaggaggaggaagtttctacagtaaatgtacggcggcga
agtgctaaaagggaacggcgatga

KEGG   Homo sapiens (human): 23244
Entry
23244             CDS       T01001                                 
Symbol
PDS5A, PIG54, SCC-112, SCC112
Name
(RefSeq) PDS5 cohesin associated factor A
  KO
K11267  sister chromatid cohesion protein PDS5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Network
nt06512  Chromosome cohesion and segregation
  Element
N01484  Establishment of cohesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    23244 (PDS5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23244 (PDS5A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    23244 (PDS5A)
SSDB
Motif
Pfam: PDS5 Cnd1 PI-TkoII_IV
Other DBs
NCBI-GeneID: 23244
NCBI-ProteinID: NP_001093869
OMIM: 613200
HGNC: 29088
Ensembl: ENSG00000121892
UniProt: Q29RF7 G1UI16
LinkDB
Position
4:complement(39822863..39977911)
AA seq 1337 aa
MDFTAQPKPATALCGVVSADGKIAYPPGVKEITDKITTDEMIKRLKMVVKTFMDMDQDSE
DEKQQYLPLALHLASEFFLRNPNKDVRLLVACCLADIFRIYAPEAPYTSHDKLKDIFLFI
TRQLKGLEDTKSPQFNRYFYLLENLAWVKSYNICFELEDCNEIFIQLFRTLFSVINNSHN
KKVQMHMLDLMSSIIMEGDGVTQELLDSILINLIPAHKNLNKQSFDLAKVLLKRTVQTIE
ACIANFFNQVLVLGRSSVSDLSEHVFDLIQELFAIDPHLLLSVMPQLEFKLKSNDGEERL
AVVRLLAKLFGSKDSDLATQNRPLWQCFLGRFNDIHVPVRLESVKFASHCLMNHPDLAKD
LTEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLLGFVRERTLDKRWRVRKEAMM
GLAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDDKLLVEKIFAQYLVPHNLET
EERMKCLYYLYASLDPNAVKALNEMWKCQNMLRSHVRELLDLHKQPTSEANCSAMFGKLM
TIAKNLPDPGKAQDFVKKFNQVLGDDEKLRSQLELLISPTCSCKQADICVREIARKLANP
KQPTNPFLEMVKFLLERIAPVHIDSEAISALVKLMNKSIEGTADDEEEGVSPDTAIRSGL
ELLKVLSFTHPTSFHSAETYESLLQCLRMEDDKVAEAAIQIFRNTGHKIETDLPQIRSTL
IPILHQKAKRGTPHQAKQAVHCIHAIFTNKEVQLAQIFEPLSRSLNADVPEQLITPLVSL
GHISMLAPDQFASPMKSVVANFIVKDLLMNDRSTGEKNGKLWSPDEEVSPEVLAKVQAIK
LLVRWLLGMKNNQSKSANSTLRLLSAMLVSEGDLTEQKRISKSDMSRLRLAAGSAIMKLA
QEPCYHEIITPEQFQLCALVINDECYQVRQIFAQKLHKALVKLLLPLEYMAIFALCAKDP
VKERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQD
VDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCD
VALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGV
LGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEEN
PVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDES
GPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQ
DLAKKAAPAERQIDLQR
NT seq 4014 nt   +upstreamnt  +downstreamnt
atggacttcaccgcgcagcccaagcctgccactgccctctgtggcgtcgtgagtgccgac
gggaagatcgcttaccctccgggggtaaaagagatcaccgacaagatcaccacggacgag
atgatcaaacgcctgaagatggtagtgaaaacctttatggatatggatcaggactcagaa
gatgaaaaacagcagtatctcccactagccttgcatcttgcatctgaattcttcctcagg
aaccccaataaagatgtgcgtctccttgtagcatgttgtttggctgatatctttcgtatc
tatgccccagaagctccatatacttcccatgataaacttaaggacatatttttgtttatt
accagacaattaaaaggtttggaggatacaaagagtccacagtttaatagatacttttat
ttattagagaatttagcttgggttaaatcatataacatctgctttgaattggaagattgc
aatgaaatttttattcagctttttagaactctcttctcagtgatcaacaatagccacaat
aagaaggtacaaatgcacatgctagatttgatgagttctatcatcatggaaggtgatgga
gttactcaagaattattggactccattcttattaacctcattcctgcacataagaactta
aataaacagtcctttgaccttgcaaaagtgctattgaaaagaacagtccagactattgag
gcatgcattgctaattttttcaatcaagtcctggtgctgggaagatcatcagtaagtgat
ttgtcagaacatgtatttgatctgattcaggaactttttgctatagatcctcatttatta
ttatccgtcatgccacagcttgaattcaaactaaagagcaatgatggagaagagcgatta
gctgttgttcgacttctagctaaattgtttggctccaaagattctgatttggcaacacag
aatcgtcctctttggcaatgttttcttggacgatttaatgatattcatgttcctgtgaga
ttagaaagtgtgaaatttgccagtcattgtttaatgaatcacccagatttagcgaaggat
ctcacagaatatttaaaggttagatcacatgatccagaagaagctattcgtcatgatgtc
attgttactataataacagctgccaagagggacctggccttagtaaatgatcagctgctt
ggctttgtaagggaaagaacactggataaacggtggcgagtaagaaaagaagctatgatg
ggtctggctcagctttataagaaatactgtcttcatggtgaagcaggaaaggaagctgca
gagaaagtcagctggataaaggacaaacttctgcatatttattatcagaacagcattgac
gacaaactgttggtagagaaaatctttgctcagtatcttgtcccccacaacctggaaaca
gaagagagaatgaaatgcttatattacttatatgctagtttggatccaaatgctgtaaaa
gctctcaacgaaatgtggaagtgtcagaacatgcttcggagccatgtacgcgaactattg
gatttgcacaagcagcctacatcagaggctaactgttctgccatgtttggaaaactgatg
accatagcaaagaatttgcctgaccccgggaaagcacaagattttgtgaagaaatttaac
caggttctcggcgatgatgagaaacttcggtctcagttggagttattaattagcccaacc
tgttcttgcaaacaagcagatatttgtgtgagagaaatagcccggaaacttgcaaatcct
aagcaaccaacaaatccttttctagagatggtcaaatttctgttggaaagaatcgcacct
gtgcacattgattcagaagccataagtgcactagtgaaattgatgaataagtcaatagag
gggacagcagatgatgaagaggagggtgtaagtccagatacagctatccgttcaggactt
gaacttcttaaggttctgtcttttacacatcctacctcgttccactctgcagagacatat
gagtccttgttacagtgcctaagaatggaggatgacaaggtagcagaagctgctattcaa
atttttagaaatacaggtcacaaaatagaaacagaccttccccagatacgatcgacctta
attcccattttacatcaaaaagcaaagaggggtactccacaccaagcaaaacaggctgtg
cactgtatacacgccatattcacaaataaagaagtccagcttgcacagatttttgagcca
ctcagtaggagtctgaatgctgatgtgccagaacaacttataactccattagtttcattg
ggccacatttctatgttagcaccagatcagtttgcttccccaatgaaatctgtagtagca
aattttattgtgaaagatctgctaatgaatgacaggtcaacaggtgaaaagaatggaaaa
ctgtggtctccagatgaagaggtttcccctgaagtactagcaaaggtacaggcaattaaa
cttctggtaaggtggctgttgggtatgaaaaacaaccagtctaaatctgccaattcaacc
cttcggttattatcagcgatgttggttagtgagggtgacctgacagagcaaaagaggatc
agtaaatctgatatgtctcgcttgcgattagctgctggtagtgccataatgaagcttgct
caggaaccttgttaccatgaaattattaccccagaacagtttcagctctgtgcacttgtt
attaatgatgagtgttaccaagtaaggcagatatttgctcagaagctgcataaggcactt
gtgaagttactgctcccattggagtatatggcgatctttgccttgtgtgccaaagatcct
gtgaaggagagaagagcacacgcacgacaatgtttactgaaaaatatcagtatacgcagg
gaatacattaagcagaatcctatggctactgagaaattattatcactgttgcctgaatat
gtagttccatacatgattcacctgctagcccatgatccagattttacaagatcacaagat
gttgatcagcttcgtgatatcaaagagtgcctatggttcatgcttgaagttttaatgaca
aagaatgaaaacaatagccatgcctttatgaagaagatggcagagaacatcaagttaacc
agagatgcccagtctccagatgaatccaagacaaatgaaaaactgtatacagtatgtgat
gtggctctctgtgttataaatagtaaaagtgctttgtgcaatgcagattcaccaaaggac
ccagtcctcccaatgaaattttttacacaacctgaaaaggacttctgtaacgataagagt
tatatttcagaagagacaagagtacttctgttaacaggaaagccaaagcctgctggagta
ctaggtgcagtaaataagcctttatcagcaacgggaaggaaaccctatgttagaagcact
ggcactgagactggaagcaatattaatgtaaattcagagctgaacccttcaaccggaaat
cgatcaagggaacagagttcagaggcagcagaaactggagttagtgaaaatgaagagaac
cctgtgaggattatttcagtcacacctgtaaagaatattgacccagtaaagaataaggaa
attaattctgatcaggctacccagggcaacatcagcagtgaccgaggaaagaaaagaaca
gtaacagcagctggtgcagagaatatccaacaaaaaacagatgagaaagtagatgaatcg
ggacctcccgccccttccaaacccaggagaggacgtcgacccaagtctgaatctcagggc
aatgctaccaaaaatgatgatctaaataaacctattaacaagggaaggaagagagctgca
gtgggtcaggagagccctgggggtttggaagcaggtaatgccaaagcacccaaactgcaa
gatttagccaaaaaggcagcaccagcagaaagacaaattgacttacaaaggtaa

DBGET integrated database retrieval system