KEGG   Homo sapiens (human): 23286
Entry
23286             CDS       T01001                                 

Gene name
WWC1, HBEBP3, HBEBP36, KIBRA, MEMRYQTL, PPP1R168
Definition
(RefSeq) WW and C2 domain containing 1
  KO
K16685  protein KIBRA
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    23286 (WWC1)
   04392 Hippo signaling pathway - multiple species
    23286 (WWC1)
SSDB
Motif
Pfam: WW C2 bZIP_Maf
Other DBs
NCBI-GeneID: 23286
NCBI-ProteinID: NP_056053
OMIM: 610533
HGNC: 29435
Ensembl: ENSG00000113645
Vega: OTTHUMG00000130408
Pharos: Q8IX03(Tbio)
UniProt: Q8IX03
LinkDB
Structure
PDB: 
2Z0U 6FB4 6FJC 6FD0 6FJD

Position
5q34
AA seq 1113 aa
MPRPELPLPEGWEEARDFDGKVYYIDHTNRTTSWIDPRDRYTKPLTFADCISDELPLGWE
EAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQEALSAQKEIYQVKQQR
LELAQQEYQQLHAVWEHKLGSQVSLVSGSSSSSKYDPEILKAEIATAKSRVNKLKREMVH
LQHELQFKERGFQTLKKIDKKMSDAQGSYKLDEAQAVLRETKAIKKAITCGEKEKQDLIK
SLAMLKDGFRTDRGSHSDLWSSSSSLESSSFPLPKQYLDVSSQTDISGSFGINSNNQLAE
KVRLRLRYEEAKRRIANLKIQLAKLDSEAWPGVLDSERDRLILINEKEELLKEMRFISPR
KWTQGEVEQLEMARKRLEKDLQAARDTQSKALTERLKLNSKRNQLVRELEEATRQVATLH
SQLKSLSSSMQSLSSGSSPGSLTSSRGSLVASSLDSSTSASFTDLYYDPFEQLDSELQSK
VEFLLLEGATGFRPSGCITTIHEDEVAKTQKAEGGGRLQALRSLSGTPKSMTSLSPRSSL
SSPSPPCSPLMADPLLAGDAFLNSLEFEDPELSATLCELSLGNSAQERYRLEEPGTEGKQ
LGQAVNTAQGCGLKVACVSAAVSDESVAGDSGVYEASVQRLGASEAAAFDSDESEAVGAT
RIQIALKYDEKNKQFAILIIQLSNLSALLQQQDQKVNIRVAVLPCSESTTCLFRTRPLDA
SDTLVFNEVFWVSMSYPALHQKTLRVDVCTTDRSHLEECLGGAQISLAEVCRSGERSTRW
YNLLSYKYLKKQSRELKPVGVMAPASGPASTDAVSALLEQTAVELEKRQEGRSSTQTLED
SWRYEETSENEAVAEEEEEEVEEEEGEEDVFTEKASPDMDGYPALKVDKETNTETPAPSP
TVVRPKDRRVGTPSQGPFLRGSTIIRSKTFSPGPQSQYVCRLNRSDSDSSTLSKKPPFVR
NSLERRSVRMKRPSSVKSLRSERLIRTSLDLELDLQATRTWHSQLTQEISVLKELKEQLE
QAKSHGEKELPQWLREDERFRLLLRMLEKRQMDRAEHKGELQTDKMMRAAAKDVHRLRGQ
SCKEPPEVQSFREKMAFFTRPRMNIPALSADDV
NT seq 3342 nt   +upstreamnt  +downstreamnt
atgccccggccggagctgcccctgccggagggctgggaggaggcgcgcgacttcgacggc
aaggtctactacatagaccacacgaaccgcaccaccagctggatcgacccgcgggacagg
tacaccaaaccgctcacctttgctgactgcattagtgatgagttgccgctaggatgggaa
gaggcatatgacccacaggttggagattacttcatagaccacaacaccaaaaccactcag
attgaggatcctcgagtacaatggcggcgggagcaggaacatatgctgaaggattacctg
gtggtggcccaggaggctctgagtgcacaaaaggagatctaccaggtgaagcagcagcgc
ctggagcttgcacagcaggagtaccagcaactgcatgccgtctgggagcataagctgggc
tcccaggtcagcttggtctctggttcatcatccagctccaagtatgaccctgagatcctg
aaagctgaaattgccactgcaaaatcccgggtcaacaagctgaagagagagatggttcac
ctccagcacgagctgcagttcaaagagcgtggctttcagaccctgaagaaaatcgataag
aaaatgtctgatgctcagggcagctacaaactggatgaagctcaggctgtcttgagagaa
acaaaagccatcaaaaaggctattacctgtggggaaaaggaaaagcaagatctcattaag
agccttgccatgttgaaggacggcttccgcactgacagggggtctcactcagacctgtgg
tccagcagcagctctctggagagttcgagtttcccgctaccgaaacagtacctggatgtg
agctcccagacagacatctcgggaagcttcggcatcaacagcaacaatcagttggcagag
aaggtcagattgcgccttcgatatgaagaggctaagagaaggatcgccaacctgaagatc
cagctggccaagcttgacagtgaggcctggcctggggtgctggactcagagagggaccgg
ctgatccttatcaacgagaaggaggagctgctgaaggagatgcgcttcatcagcccccgc
aagtggacccagggggaggtggagcagctggagatggcccggaagcggctggaaaaggac
ctgcaggcagcccgggacacccagagcaaggcgctgacggagaggttaaagttaaacagt
aagaggaaccagcttgtgagagaactggaggaagccacccggcaggtggcaactctgcac
tcccagctgaaaagtctctcaagcagcatgcagtccctgtcctcaggcagcagccccgga
tccctcacgtccagccggggctccctggttgcatccagcctggactcctccacttcagcc
agcttcactgacctctactatgacccctttgagcagctggactcagagctgcagagcaag
gtggagttcctgctcctggagggggccaccggcttccggccctcaggctgcatcaccacc
atccacgaggatgaggtggccaagacccagaaggcagagggaggtggccgcctgcaggct
ctgcgttccctgtctggcaccccaaagtccatgacctccctatccccacgttcctctctc
tcctccccctccccaccctgttcccctctcatggctgaccccctcctggctggtgatgcc
ttcctcaactccttggagtttgaagacccggagctgagtgccactctttgtgaactgagc
cttggtaacagcgcccaggaaagataccggctggaggaaccaggaacggagggcaagcag
ctgggccaagctgtgaatacggcccaggggtgtggcctgaaagtggcctgtgtctcagcc
gccgtatcggacgagtcagtggctggagacagtggtgtgtacgaggcttccgtgcagaga
ctgggtgcttcagaagctgctgcatttgacagtgacgaatcggaagcagtgggtgcgacc
cgaattcagattgccctgaagtatgatgagaagaataagcaatttgcaatattaatcatc
cagctgagtaacctttctgctctgttgcagcaacaagaccagaaagtgaatatccgcgtg
gctgtccttccttgctctgaaagcacaacctgcctgttccggacccggcctctggacgcc
tcagacactctagtgttcaatgaggtgttctgggtatccatgtcctatccagcccttcac
cagaagaccttaagagtcgatgtctgtaccaccgacaggagccatctggaagagtgcctg
ggaggcgcccagatcagcctggcggaggtctgccggtctggggagaggtcgactcgctgg
tacaaccttctcagctacaaatacttgaagaaacagagcagggagctcaagccagtggga
gtcatggcccctgcctcagggcctgccagcacggacgctgtgtctgctctgttggaacag
acagcagtggagctggagaagaggcaggagggcaggagcagcacacagacactggaagac
agctggaggtatgaggagaccagtgagaatgaggcagtagccgaggaagaggaggaggag
gtggaggaggaggagggagaagaggatgttttcaccgagaaagcctcacctgatatggat
gggtacccagcattaaaggtggacaaagagaccaacacggagaccccggccccatccccc
acagtggtgcgacctaaggaccggagagtgggcaccccgtcccaggggccatttcttcga
gggagcaccatcatccgctctaagaccttctccccaggaccccagagccagtacgtgtgc
cggctgaatcggagtgatagtgacagctccactctgtccaaaaagccaccttttgttcga
aactccctggagcgacgcagcgtccggatgaagcggccttcctcggtcaagtcgctgcgc
tccgagcgtctgatccgtacctcgctggacctggagttagacctgcaggcgacaagaacc
tggcacagccaattgacccaggagatctcggtgctgaaggagctcaaggagcagctggaa
caagccaagagccacggggagaaggagctgccacagtggttgcgtgaggacgagcgtttc
cgcctgctgctgaggatgctggagaagcggcagatggaccgagcggagcacaagggtgag
cttcagacagacaagatgatgagggcagctgccaaggatgtgcacaggctccgaggccag
agctgtaaggaacccccagaagttcagtctttcagggagaagatggcatttttcacccgg
cctcggatgaatatcccagctctctctgcagatgacgtctaa

DBGET integrated database retrieval system