KEGG   Homo sapiens (human): 23418
Entry
23418             CDS       T01001                                 
Symbol
CRB1, CRB1-A, CRB1-B, CRB1-C, LCA8, RP12
Name
(RefSeq) crumbs cell polarity complex component 1
  KO
K16681  protein crumbs
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
Disease
H00527  Retinitis pigmentosa
H00837  Leber congenital amaurosis
H01088  Pigmented paravenous chorioretinal atrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    23418 (CRB1)
SSDB
Motif
Pfam: EGF Laminin_G_2 hEGF Laminin_G_1 EGF_CA EGF_3 EGF_2 Laminin_G_3 cEGF SH3_6
Other DBs
NCBI-GeneID: 23418
NCBI-ProteinID: NP_957705
OMIM: 604210
HGNC: 2343
Ensembl: ENSG00000134376
Pharos: P82279(Tbio)
UniProt: P82279 A0A7D6VM04
Structure
LinkDB
Position
1:197201504..197478455
AA seq 1406 aa
MALKNINYLLIFYLSFSLLIYIKNSFCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTA
NNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQ
HGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQG
RHCDLEVDECASDPCKNEATCLNEIGRYTCICPHNYSGVNCELEIDECWSQPCLNGATCQ
DALGAYFCDCAPGFLGDHCELNTDECASQPCLHGGLCVDGENRYSCNCTGSGFTGTHCET
LMPLCWSKPCHNNATCEDSVDNYTCHCWPGYTGAQCEIDLNECNSNPCQSNGECVELSSE
KQYGRITGLPSSFSYHEASGYVCICQPGFTGIHCEEDVNECSSNPCQNGGTCENLPGNYT
CHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGTCIPHFQDGQHGFSCLCPSGYTGSLC
EIATTLSFEGDGFLWVKSGSVTTKGSVCNIALRFQTVQPMALLLFRSNRDVFVKLELLSG
YIHLSIQVNNQSKVLLFISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKEKCIAKAPTPLE
SDQSICAFQNSFLGGLPVGMTSNGVALLNFYNMPSTPSFVGCLQDIKIDWNHITLENISS
GSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDD
STGYVIFTLDESYGDTISLSMFVRTLQPSGLLLALENSTYQYIRVWLERGRLAMLTPNSP
KLVVKFVLNDGNVHLISLKIKPYKIELYQSSQNLGFISASTWKIEKGDVIYIGGLPDKQE
TELNGGFFKGCIQDVRLNNQNLEFFPNPTNNASLNPVLVNVTQGCAGDNSCKSNPCHNGG
VCHSRWDDFSCSCPALTSGKACEEVQWCGFSPCPHGAQCQPVLQGFECIANAVFNGQSGQ
ILFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQSGNSFYM
LSLTSLQSVNDGTWHEVTLSMTDPLSQTSRWQMEVDNETPFVTSTIATGSLNFLKDNTDI
YVGDRAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFINKPQEEQFLKISTNSVVTGCLQL
NVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNIDECFSNPCIHGNCSDRVAAYHC
TCEPGYTGVNCEVDIDNCQSHQCANGATCISHTNGYSCLCFGNFTGKFCRQSRLPSTVCG
NEKTNLTCYNGGNCTEFQTELKCMCRPGFTGEWCEKDIDECASDPCVNGGLCQDLLNKFQ
CLCDVAFAGERCEVDLADDLISDIFTTIGSVTVALLLILLLAIVASVVTSNKRATQGTYS
PSRQEKEGSRVEMWNLMPPPAMERLI
NT seq 4221 nt   +upstreamnt  +downstreamnt
atggcacttaagaacattaactaccttctcatcttctacctcagtttctcactgcttatc
tacataaaaaattccttttgcaataaaaacaacaccaggtgcctctcaaattcttgccaa
aacaattctacatgcaaagatttttcaaaagacaatgattgttcttgttcagacacagcc
aataatttggacaaagactgtgacaacatgaaagacccttgcttctccaatccctgtcaa
ggaagtgccacttgtgtgaacaccccaggagaaaggagctttctgtgcaaatgtcctcct
gggtacagtgggacaatctgtgaaactaccattggttcctgtggcaagaactcctgccaa
catggaggtatttgccatcaggaccctatttatcctgtctgcatctgccctgctggatat
gctggaagattctgtgagatagatcacgatgagtgtgcttccagcccttgccaaaatggg
gccgtgtgccaggatggaattgatggttactcctgcttctgtgtcccaggatatcaaggc
agacactgcgacttggaagtggatgaatgtgcttcagatccctgcaagaacgaggctaca
tgcctcaatgaaataggaagatatacttgtatctgtccccacaattattctggtgtaaac
tgtgaattggaaattgacgaatgttggtcccagccttgtttaaatggtgcaacttgtcag
gatgctctgggggcctatttctgcgactgtgcccctggattcctgggggatcactgtgaa
ctcaacactgatgagtgtgccagtcaaccttgtctccatggagggctgtgtgtggatgga
gaaaacagatatagctgtaactgcacgggtagtggattcacagggacacactgtgagacc
ttgatgcctctttgttggtcaaaaccttgtcacaataatgctacatgtgaggacagtgtt
gacaattacacttgtcactgctggcctggatacacaggtgcccagtgtgagatcgacctc
aatgaatgcaatagtaacccctgccagtccaatggggaatgtgtggagctgtcctcagag
aaacaatatggacgcatcactggactgccttcttctttcagctaccatgaagcctcaggt
tatgtctgtatctgtcagcctggattcacaggaatccactgcgaagaagacgtcaatgaa
tgttcttcaaacccttgccaaaatggtggtacttgtgagaacttgcctgggaattatact
tgccattgcccatttgataacctttctagaactttttatggaggaagggactgttctgat
attctcctgggctgtacccatcagcaatgtctaaataatggaacatgcatccctcacttc
caagatggccagcatggattcagctgcctatgtccatctggctacaccgggtccctgtgt
gaaatcgcaaccacactttcatttgagggcgatggcttcctgtgggtcaaaagtggctca
gtgacaaccaagggctcagtttgtaacatagccctcaggtttcagactgttcagccaatg
gctcttctacttttccgaagcaacagggatgtgtttgtgaagctggagctgctaagtggc
tacattcacttatcaattcaggtcaataatcagtcaaaggtgcttctgttcatttcccac
aacaccagcgatggagagtggcatttcgtggaggtaatatttgcagaggctgtgaccctt
accttaatcgacgactcctgtaaggagaaatgcatcgcgaaagctcctactccacttgaa
agtgatcaatcaatatgtgcttttcagaactcctttttgggtggtttaccagtgggaatg
accagcaatggtgttgctctgcttaacttctataatatgccatccacaccttcgtttgta
ggctgtctccaagacattaaaattgattggaatcacattaccctggagaacatctcgtct
ggctcatcattaaatgtcaaggcaggctgtgtgagaaaggattggtgtgaaagccaacct
tgtcaaagcagaggacgctgcatcaacttgtggctgagttaccagtgtgactgccacagg
ccctatgaaggccccaactgtctgagagagtatgtggcaggcagatttggccaggatgac
tccactggttatgtcatctttactcttgatgagagctatggagacaccatcagcctctcc
atgtttgtccgaacgcttcaaccatcaggcttacttctagctttggaaaacagcacttat
caatatatccgtgtctggctagagcgcggcagactagcaatgctgactccaaactctccc
aaattagtagtaaaatttgttcttaatgatggaaatgtccacttgatatctttgaaaatc
aagccatataaaattgaactgtatcagtcttcacaaaacctaggatttatttctgcttct
acgtggaaaatcgaaaagggagatgtcatctacattggtggcctacctgacaagcaagag
actgaacttaatggtggattcttcaaaggctgtatccaagatgtaagactaaacaaccaa
aatctggaattctttccaaatccaacaaacaatgcatctctcaatccagttcttgtcaat
gtaacccaaggctgtgctggagacaacagctgcaagtccaacccctgtcacaatggaggt
gtttgccattcccggtgggatgacttctcctgttcctgtcctgccctcacaagtgggaaa
gcctgtgaggaggttcagtggtgtggattcagcccgtgtcctcacggagcccagtgccag
ccggtgcttcaaggatttgaatgtattgcaaatgctgtttttaatggacaaagcggtcaa
atattattcagaagcaatgggaatattaccagagaactcaccaatatcacatttggtttc
agaacaagggatgcaaatgtaataatattgcatgcagaaaaagagcctgaatttcttaat
attagcattcaagattccagattattctttcaattgcaaagtggcaacagcttttatatg
ctaagtctgacaagtttgcagtcagtgaatgatggcacatggcacgaagtgaccctttcc
atgacagacccactgtcccagacctccaggtggcaaatggaagtggacaacgaaacacct
tttgtgaccagcacaattgctactggaagcctcaactttttgaaggataatacagatatt
tatgtgggagacagagctattgacaatataaagggcctgcaagggtgtctaagtacaata
gaaatcggaggcatttatctctcttactttgaaaatgttcatggtttcattaataaacct
caggaagagcaatttctcaaaatctctaccaattcagtggtcactggctgtttgcagtta
aatgtctgcaactccaacccctgtttgcatggaggaaactgtgaagacatctatagctct
tatcattgctcctgtcccttgggatggtcagggaaacactgtgaactcaacatcgatgaa
tgcttttcaaacccctgtatccatggcaactgctctgacagagttgcagcctaccactgc
acatgtgagcctggatacactggtgtgaactgtgaagtggatatagacaactgccagagt
caccagtgtgcaaatggagccacctgcattagtcatactaatggctattcttgcctctgt
tttggaaattttacaggaaaattttgcagacagagcagattaccctcaacagtctgtggg
aatgagaagacaaatctcacttgctacaatggaggcaactgcacagagttccagactgaa
ttaaaatgtatgtgccggccaggttttactggagaatggtgtgaaaaggacattgatgag
tgtgcctctgatccgtgtgtcaatggaggtctgtgccaggacttactcaacaaattccag
tgcctctgtgatgttgcctttgctggcgagcgctgcgaggtggacttggcagatgacttg
atctccgacattttcaccactattggctcagtgactgtcgccttgttactgatcctcttg
ctggccattgttgcttctgttgtcacctccaacaaaagggcaactcagggaacctacagc
cccagccgtcaggagaaggagggctcccgagtggaaatgtggaacttgatgccaccccct
gcaatggagagactgatttag

DBGET integrated database retrieval system