KEGG   Homo sapiens (human): 2348
Entry
2348              CDS       T01001                                 
Symbol
FOLR1, FBP, FOLR, FRalpha, NCFTD
Name
(RefSeq) folate receptor alpha
  KO
K13649  folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04144  Endocytosis
Disease
H01295  Neurodegeneration due to cerebral folate transport deficiency
Drug target
Farletuzumab: D09343
Farletuzumab ecteribulin: D12183
Mirvetuximab: D10953
Mirvetuximab soravtansine: D10954
Pafolacianine (DG03206): D12249 D12250<US>
Vintafolide: D10434
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    2348 (FOLR1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    2348 (FOLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2348 (FOLR1)
   04147 Exosome [BR:hsa04147]
    2348 (FOLR1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2348 (FOLR1)
Transporters [BR:hsa02000]
 Other transporters
  Others
   2348 (FOLR1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2348 (FOLR1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2348 (FOLR1)
SSDB
Motif
Pfam: Folate_rec
Other DBs
NCBI-GeneID: 2348
NCBI-ProteinID: NP_000793
OMIM: 136430
HGNC: 3791
Ensembl: ENSG00000110195
Pharos: P15328(Tchem)
UniProt: P15328 A0A024R5H1
Structure
LinkDB
Position
11:72189709..72196323
AA seq 257 aa
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS
NT seq 774 nt   +upstreamnt  +downstreamnt
atggctcagcggatgacaacacagctgctgctccttctagtgtgggtggctgtagtaggg
gaggctcagacaaggattgcatgggccaggactgagcttctcaatgtctgcatgaacgcc
aagcaccacaaggaaaagccaggccccgaggacaagttgcatgagcagtgtcgaccctgg
aggaagaatgcctgctgttctaccaacaccagccaggaagcccataaggatgtttcctac
ctatatagattcaactggaaccactgtggagagatggcacctgcctgcaaacggcatttc
atccaggacacctgcctctacgagtgctcccccaacttggggccctggatccagcaggtg
gatcagagctggcgcaaagagcgggtactgaacgtgcccctgtgcaaagaggactgtgag
caatggtgggaagattgtcgcacctcctacacctgcaagagcaactggcacaagggctgg
aactggacttcagggtttaacaagtgcgcagtgggagctgcctgccaacctttccatttc
tacttccccacacccactgttctgtgcaatgaaatctggactcactcctacaaggtcagc
aactacagccgagggagtggccgctgcatccagatgtggttcgacccagcccagggcaac
cccaatgaggaggtggcgaggttctatgctgcagccatgagtggggctgggccctgggca
gcctggcctttcctgcttagcctggccctaatgctgctgtggctgctcagctga

KEGG   Homo sapiens (human): 2350
Entry
2350              CDS       T01001                                 
Symbol
FOLR2, BETA-HFR, FBP, FBP/PL-1, FOLR1, FR-BETA, FR-P3, FRbeta
Name
(RefSeq) folate receptor beta
  KO
K13649  folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04144  Endocytosis
Drug target
Pafolacianine (DG03206): D12249 D12250<US>
Vintafolide: D10434
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    2350 (FOLR2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    2350 (FOLR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2350 (FOLR2)
   04147 Exosome [BR:hsa04147]
    2350 (FOLR2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2350 (FOLR2)
Transporters [BR:hsa02000]
 Other transporters
  Others
   2350 (FOLR2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2350 (FOLR2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2350 (FOLR2)
SSDB
Motif
Pfam: Folate_rec
Other DBs
NCBI-GeneID: 2350
NCBI-ProteinID: NP_000794
OMIM: 136425
HGNC: 3793
Ensembl: ENSG00000165457
Pharos: P14207(Tchem)
UniProt: P14207
Structure
LinkDB
Position
11:72216794..72221950
AA seq 255 aa
MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACC
TASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRK
ERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPA
ALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGG
LLLSLALMLQLWLLG
NT seq 768 nt   +upstreamnt  +downstreamnt
atggtctggaaatggatgccacttctgctgcttctggtctgtgtagccaccatgtgcagt
gcccaggacaggactgatctcctcaatgtctgtatggatgccaagcaccacaagacaaag
ccaggtcctgaggacaagctgcatgaccaatgcagtccctggaagaagaatgcctgctgc
acagccagcaccagccaggagctgcacaaggacacctcccgcctgtacaactttaactgg
gaccactgcggcaagatggagcccgcctgcaagcgccacttcatccaggacacctgtctc
tatgagtgctcacccaacctggggccctggatccagcaggtgaatcagagctggcgcaaa
gaacgcttcctggatgtgcccttatgcaaagaggactgtcagcgctggtgggaggattgt
cacacctcccacacgtgcaagagcaactggcacagaggatgggactggacctcaggagtt
aacaagtgcccagctggggctctctgccgcacctttgagtcctacttccccactccagct
gccctttgtgaaggcctctggagtcactcatacaaggtcagcaactacagccgagggagc
ggccgctgcatccagatgtggtttgattcagcccagggcaaccccaacgaggaagtggcg
aggttctatgctgcagccatgcatgtgaatgctggtgagatgcttcatgggactgggggt
ctcctgctcagtctggccctgatgctgcaactctggctccttggctga

KEGG   Homo sapiens (human): 2352
Entry
2352              CDS       T01001                                 
Symbol
FOLR3, FR-G, FR-gamma, FRgamma, gamma-hFR
Name
(RefSeq) folate receptor gamma
  KO
K13649  folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04144  Endocytosis
Drug target
Pafolacianine (DG03206): D12249 D12250<US>
Vintafolide: D10434
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    2352 (FOLR3)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    2352 (FOLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2352 (FOLR3)
   04147 Exosome [BR:hsa04147]
    2352 (FOLR3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2352 (FOLR3)
Transporters [BR:hsa02000]
 Other transporters
  Others
   2352 (FOLR3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2352 (FOLR3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2352 (FOLR3)
SSDB
Motif
Pfam: Folate_rec Glyco_transf_8C
Other DBs
NCBI-GeneID: 2352
NCBI-ProteinID: NP_000795
OMIM: 602469
HGNC: 3795
Ensembl: ENSG00000110203
Pharos: P41439(Tdark)
UniProt: P41439
LinkDB
Position
11:72135725..72139892
AA seq 245 aa
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPW
KKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQV
NQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFES
YFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSR
GIIDS
NT seq 738 nt   +upstreamnt  +downstreamnt
atggacatggcctggcagatgatgcagctgctgcttctggctttggtgactgctgcgggg
agtgcccagcccaggagtgcgcgggccaggacggacctgctcaatgtctgcatgaacgcc
aagcaccacaagacacagcccagccccgaggacgagctgtatggccagtgcagtccctgg
aagaagaatgcctgctgcacggccagcaccagccaggagctgcacaaggacacctcccgc
ctgtacaactttaactgggatcactgtggtaagatggaacccacctgcaagcgccacttt
atccaggacagctgtctctatgagtgctcacccaacctggggccctggatccggcaggtc
aaccagagctggcgcaaagagcgcattctgaacgtgcccctgtgcaaagaggactgtgag
cgctggtgggaggactgtcgcacctcctacacctgcaaaagcaactggcacaaaggctgg
aattggacctcagggattaatgagtgtccggccggggccctctgcagcacctttgagtcc
tacttccccactccagccgccctttgtgaaggcctctggagccactccttcaaggtcagc
aactatagtcgagggagcggccgctgcatccagatgtggtttgactcagcccagggcaac
cccaatgaggaggtggccaagttctatgctgcggccatgaatgctggggccccgtctcgt
gggattattgattcctga

DBGET integrated database retrieval system