KEGG   Homo sapiens (human): 23511
Entry
23511             CDS       T01001                                 
Symbol
NUP188, KIAA0169, SANDSTEF, hNup188
Name
(RefSeq) nucleoporin 188
  KO
K14311  nuclear pore complex protein Nup188
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    23511 (NUP188)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    23511 (NUP188)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23511 (NUP188)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     23511 (NUP188)
SSDB
Motif
Pfam: Nup188 Gar1
Other DBs
NCBI-GeneID: 23511
NCBI-ProteinID: NP_056169
OMIM: 615587
HGNC: 17859
Ensembl: ENSG00000095319
Vega: OTTHUMG00000020768
Pharos: Q5SRE5(Tbio)
UniProt: Q5SRE5
Structure
LinkDB
Position
9:128947699..129007096
AA seq 1749 aa
MAAAAGGPCVRSSRELWTILLGRSALRELSQIEAELNKHWRRLLEGLSYYKPPSPSSAEK
VKANKDVASPLKELGLRISKFLGLDEEQSVQLLQCYLQEDYRGTRDSVKTVLQDERQSQA
LILKIADYYYEERTCILRCVLHLLTYFQDERHPYRVEYADCVDKLEKELVSKYRQQFEEL
YKTEAPTWETHGNLMTERQVSRWFVQCLREQSMLLEIIFLYYAYFEMAPSDLLVLTKMFK
EQGFGSRQTNRHLVDETMDPFVDRIGYFSALILVEGMDIESLHKCALDDRRELHQFAQDG
LICQDMDCLMLTFGDIPHHAPVLLAWALLRHTLNPEETSSVVRKIGGTAIQLNVFQYLTR
LLQSLASGGNDCTTSTACMCVYGLLSFVLTSLELHTLGNQQDIIDTACEVLADPSLPELF
WGTEPTSGLGIILDSVCGMFPHLLSPLLQLLRALVSGKSTAKKVYSFLDKMSFYNELYKH
KPHDVISHEDGTLWRRQTPKLLYPLGGQTNLRIPQGTVGQVMLDDRAYLVRWEYSYSSWT
LFTCEIEMLLHVVSTADVIQHCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRL
TTVISPPVDVIASCVNCLTVLAARNPAKVWTDLRHTGFLPFVAHPVSSLSQMISAEGMNA
GGYGNLLMNSEQPQGEYGVTIAFLRLITTLVKGQLGSTQSQGLVPCVMFVLKEMLPSYHK
WRYNSHGVREQIGCLILELIHAILNLCHETDLHSSHTPSLQFLCICSLAYTEAGQTVINI
MGIGVDTIDMVMAAQPRSDGAEGQGQGQLLIKTVKLAFSVTNNVIRLKPPSNVVSPLEQA
LSQHGAHGNNLIAVLAKYIYHKHDPALPRLAIQLLKRLATVAPMSVYACLGNDAAAIRDA
FLTRLQSKIEDMRIKVMILEFLTVAVETQPGLIELFLNLEVKDGSDGSKEFSLGMWSCLH
AVLELIDSQQQDRYWCPPLLHRAAIAFLHALWQDRRDSAMLVLRTKPKFWENLTSPLFGT
LSPPSETSEPSILETCALIMKIICLEIYYVVKGSLDQSLKDTLKKFSIEKRFAYWSGYVK
SLAVHVAETEGSSCTSLLEYQMLVSAWRMLLIIATTHADIMHLTDSVVRRQLFLDVLDGT
KALLLVPASVNCLRLGSMKCTLLLILLRQWKRELGSVDEILGPLTEILEGVLQADQQLME
KTKAKVFSAFITVLQMKEMKVSDIPQYSQLVLNVCETLQEEVIALFDQTRHSLALGSATE
DKDSMETDDCSRSRHRDQRDGVCVLGLHLAKELCEVDEDGDSWLQVTRRLPILPTLLTTL
EVSLRMKQNLHFTEATLHLLLTLARTQQGATAVAGAGITQSICLPLLSVYQLSTNGTAQT
PSASRKSLDAPSWPGVYRLSMSLMEQLLKTLRYNFLPEALDFVGVHQERTLQCLNAVRTV
QSLACLEEADHTVGFILQLSNFMKEWHFHLPQLMRDIQVNLGYLCQACTSLLHSRKMLQH
YLQNKNGDGLPSAVAQRVQRPPSAASAAPSSSKQPAADTEASEQQALHTVQYGLLKILSK
TLAALRHFTPDVCQILLDQSLDLAEYNFLFALSFTTPTFDSEVAPSFGTLLATVNVALNM
LGELDKKKEPLTQAVGLSTQAEGTRTLKSLLMFTMENCFYLLISQAMRYLRDPAVHPRDK
QRMKQELSSELSTLLSSLSRYFRRGAPSSPATGVLPSPQGKSTSLSKASPESQEPLIQLV
QAFVRHMQR
NT seq 5250 nt   +upstreamnt  +downstreamnt
atggcggcggccgccggcgggccgtgtgtgaggagcagtagagaactgtggactattctg
cttggaaggtcagctctgagagagctgagtcagattgaggcagaactgaataaacattgg
cggcgattgttagaggggctttcttactacaaacctcccagtccaagttcagctgaaaaa
gtgaaagctaataaagatgtagcttcaccattgaaggaactgggtttaagaatcagcaag
tttttgggtcttgatgaagaacagagtgtgcagttactccagtgttacctgcaagaggac
tacaggggtactcgggactcagtaaagacagtactgcaagatgagaggcagagccaggcc
ttaatcctgaagattgcagattattattatgaagaaagaacctgtattcttcgttgtgtc
ttacaccttctcacttacttccaagatgaaagacacccctatagggttgaatatgcagac
tgtgttgataaattggagaaggaactagtttcaaaatacagacagcagttcgaagagctt
tataaaactgaagcaccaacttgggagacacatggaaatctcatgacagagcgccaagtg
tctcgctggtttgttcagtgccttcgggaacagtccatgctgctagaaattattttcctt
tattatgcatactttgagatggcacccagtgacttacttgtattaaccaagatgtttaaa
gagcaaggatttggtagtaggcagaccaataggcacctggtggatgagactatggatcct
tttgtagatcggattggctacttcagtgccctcatcctggtggagggcatggatatcgag
tccttgcataagtgtgctttggatgacagaagagaactgcatcagtttgcgcaggatggg
cttatttgtcaggatatggactgtttaatgttgacctttggggacattccacatcatgcc
ccagtgcttttggcctgggctctcctccgtcacactctgaacccagaagagacaagcagt
gtggtccggaagataggtggcacagccatccagctgaatgtgtttcagtacttgacccga
ttgctccagtcccttgccagtgggggaaatgattgcaccaccagcactgcatgcatgtgt
gtctatggactgctctctttcgttctgacctcgttggagctgcacaccctgggcaatcag
caggatataattgatacagcatgtgaagtattggccgacccttctcttccggaactgttc
tggggaacagagccaacttctggccttgggatcattctggacagtgtgtgtggaatgttt
ccccaccttctctccccactcctgcaactgctccgagccctggtatcagggaagtccaca
gccaaaaaggtgtatagcttcttggataagatgtctttctacaatgaactttataaacac
aagcctcatgatgtgatctcccatgaagatggaactctttggcggagacaaacacccaaa
ctcctttatccccttgggggtcaaaccaaccttcgcatacctcaaggcactgtgggccaa
gtaatgttggatgatagggcatacctggtacgctgggaatactcctatagcagctggacc
ctctttacctgcgagattgaaatgttgcttcatgttgtttcaactgcagatgtgattcag
cactgccagcgagtcaaacccatcattgatctcgtccataaggtcatcagtacagacctg
tcgatagcagactgtctcctgcccatcacatctcgcatctacatgctgctgcagcggtta
acgacagtgatctccccacctgtggatgtcattgcttcttgtgtcaactgcttaactgtt
ttggctgcccgcaatccagcaaaggtctggactgatcttcgtcacacaggttttttacca
tttgtggcccatcctgtctccagcctgagtcagatgattagtgcggaagggatgaatgct
ggagggtacggaaacctcttgatgaacagtgaacagcctcagggcgagtatggggttact
attgcctttctgcgcttgatcaccacccttgtcaaggggcaacttggtagtacccagagc
caaggacttgtaccctgtgtaatgtttgtgctgaaggagatgcttcccagctaccataag
tggcgctacaactctcatggagtgagggaacagattggttgcctgatcttggagctgatt
catgcgatactgaacctgtgccacgagacagacctgcacagcagtcatactcccagcctg
cagtttctctgcatctgcagcctggcatacacagaagcaggacagacagttatcaatatc
atgggcattggcgtggacaccattgacatggtgatggctgctcagcctcgaagtgatggg
gcagagggccaggggcagggccagctgctgatcaagacagtgaaactggcattctccgtc
accaacaatgttattcggctgaaacctccttctaatgtggtgtcccccctggaacaggct
ctctcacaacatggtgctcatggaaacaacctcattgctgttctagccaaatacatctac
cacaaacatgaccctgctttgccacgtcttgccattcagctgctgaaacgtctggccacg
gtggccccaatgtcagtgtatgcttgtctgggcaatgatgcggctgccattcgtgatgcc
ttcctgacccgattgcagagcaaaattgaggacatgcgcatcaaagtcatgattctagag
ttcctcactgttgcagtagagacccagccaggcctcatcgaactgtttctgaacctggaa
gttaaggatggcagtgatggctcaaaggaattcagccttgggatgtggagctgtctccat
gcagtgctggagctgattgattcccaacagcaagatcgatactggtgcccacccctgctg
catcgtgccgccattgcctttttgcatgctctgtggcaggatcggagggacagtgccatg
ctggtcctccgaaccaaacccaagttttgggaaaatttaaccagtccgctgtttggaacc
ctttctcctccctctgaaacatcagagcccagcatcctggaaacctgtgccctaatcatg
aagataatttgcttggagatatactatgtagtaaagggttcattagaccagtcattaaag
gatacactgaagaaattttccatcgagaaacgctttgcctactggtcagggtatgtcaag
tcattggcagttcacgtggccgaaacagaaggcagcagctgcacctccttgttagagtac
cagatgctggtgtccgcctggaggatgcttctcatcattgccaccactcatgcagatata
atgcacctgactgactctgtggtgcgtcgccagctctttcttgacgtgcttgatggaacc
aaagcattactcctagttccagcctcagtgaactgccttcgccttggctccatgaagtgc
actctgctgcttatcctcctccggcagtggaagagagagttaggttctgtggatgaaatc
cttggacccttgacggagatcctggagggagtgctgcaggccgaccagcaactcatggag
aagaccaaggccaaggtgttctcagcattcatcacagtgttgcaaatgaaggagatgaaa
gtaagtgacatcccccagtactcccagctggtgctgaatgtctgtgagaccctccaagag
gaagtgattgcactcttcgaccagacccgccacagtctggcattaggcagtgccacagag
gacaaggacagcatggagactgacgactgttctcggtcccggcacagggaccagcgtgat
ggggtgtgtgtcctgggcctgcacctggccaaggagctgtgtgaggtagacgaggatggt
gactcctggctgcaggtaacccgcaggctccccatcctacccaccctcctcaccactcta
gaggtgagccttcgcatgaagcagaacctgcatttcactgaggccacattgcatctgctc
ctcaccctggctcgcactcagcagggagccacagcagtggctggagctggcatcacccag
agcatttgtttgccccttctgagtgtgtaccagctgagcaccaacggcacagcacagaca
cctagtgcctctcggaagtccctggatgccccctcttggccaggagtctaccgcctgtcc
atgtccctgatggagcagctgctcaaaactctgcgctacaacttcctgcctgaggccctg
gacttcgtgggtgtccaccaggagcggaccttacagtgcctcaacgcagtgaggacagtg
cagagtctggcctgcctggaggaggcggaccacaccgtgggttttattctgcagctctct
aacttcatgaaggagtggcacttccacctgcctcagctcatgcgtgatatccaggtcaac
ctgggttacttgtgccaggcatgtacctctctcctgcacagtcgaaagatgctgcagcat
tacttacagaacaaaaatggggatggcctcccctcagctgttgcccagcgagtccagagg
ccaccgtctgctgcttctgctgccccctcctcctcaaagcagcccgctgctgacacagag
gcatcagagcagcaggccttgcacacagtccagtatggccttctcaagatcctcagcaag
acgctggcagccctgcgccacttcaccccagatgtctgccagattctgctggatcagtcc
ctggaccttgctgaatacaacttcctgtttgccctgagctttaccactcccacctttgac
tccgaagtggccccctccttcgggacccttctggccacagtgaatgtggccctcaacatg
cttggagagctggacaagaaaaaggagcccctcacccaggcagtggggctcagcacacag
gcagaagggaccaggacgttaaagtccctcctgatgtttaccatggaaaactgcttctac
ctgctcatctctcaggcgatgcggtaccttagggacccggctgtgcacccccgggacaaa
cagcggatgaagcaggagctcagctctgagttgagcacgctgctgtccagcctctcgcgc
tacttccgccggggagcccccagctcccctgccactggtgtcctcccctcgccgcagggc
aagtccacctctctctccaaagccagccctgagagtcaggagcctctgatccagttggtg
caggcgtttgtccggcatatgcaaagatag

DBGET integrated database retrieval system