Homo sapiens (human): 23562 Help Entry 23562             CDS       T01001                                  Symbol CLDN14, DFNB29 Name (RefSeq) claudin 14   KO K06087   claudin Organism hsa  Homo sapiens (human) Pathway hsa03272   Virion - Hepatitis viruses hsa04382   Cornified envelope formation hsa04514   Cell adhesion molecules hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa05130   Pathogenic Escherichia coli infection hsa05160   Hepatitis C Network nt06180  Pathogenic Escherichia coli   Element N01287   Tight junction-Actin signaling pathway Disease H00605   Deafness, autosomal recessive Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     23562 (CLDN14)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     23562 (CLDN14)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     23562 (CLDN14)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     23562 (CLDN14)   09158 Development and regeneration    04382 Cornified envelope formation     23562 (CLDN14)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     23562 (CLDN14)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     23562 (CLDN14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     23562 (CLDN14)    04147 Exosome [BR:hsa04147]     23562 (CLDN14)    04515 Cell adhesion molecules [BR:hsa04515]     23562 (CLDN14) Cilium and associated proteins [BR:hsa03037]  Other cilia and associated proteins   Stereociliary proteins    23562 (CLDN14) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    23562 (CLDN14)   Exosomal proteins of colorectal cancer cells    23562 (CLDN14) Cell adhesion molecules [BR:hsa04515]  Immunoglobulin superfamily   L1 family    23562 (CLDN14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 zf-Tbcl_FmdE Amastin Motif Other DBs NCBI-GeneID:  23562 NCBI-ProteinID:  NP_001139549 OMIM:  605608 HGNC:  2035 Ensembl:  ENSG00000159261 UniProt:  O95500 LinkDB All DBs Position 21:complement(36460621..36576569) Genome browser AA seq 239 aa AA seqDB search MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTG IYQCQIYRSLLALPQDLQAARALMVISCLLSGIACACAVIGMKCTRCAKGTPAKTTFAIL GGTLFILAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTL LCLSCQDEAPYRPYQAPPRATTTTANTAPAYQPPAAYKDNRAPSVTSATHSGYRLNDYV NT seq 720 nt NT seq  +upstreamnt  +downstreamnt atggccagcacggccgtgcagcttctgggcttcctgctcagcttcctgggcatggtgggc acgttgatcaccaccatcctgccgcactggcggaggacagcgcacgtgggcaccaacatc ctcacggccgtgtcctacctgaaagggctctggatggagtgtgtgtggcacagcacaggc atctaccagtgccagatctaccgatccctgctggcgctgccccaagacctccaggctgcc cgcgccctcatggtcatctcctgcctgctctcgggcatagcctgcgcctgcgccgtcatc gggatgaagtgcacgcgctgcgccaagggcacacccgccaagaccacctttgccatcctc ggcggcaccctcttcatcctggccggcctcctgtgcatggtggccgtctcctggaccacc aacgacgtggtgcagaacttctacaacccgctgctgcccagcggcatgaagtttgagatt ggccaggccctgtacctgggcttcatctcctcgtccctctcgctcattggtggcaccctg ctttgcctgtcctgccaggacgaggcaccctacaggccctaccaggccccgcccagggcc accacgaccactgcaaacaccgcacctgcctaccagccaccagctgcctacaaagacaat cgggccccctcagtgacctcggccacgcacagcgggtacaggctgaacgactacgtgtga

DBGET integrated database retrieval system