KEGG   Homo sapiens (human): 23636
Entry
23636             CDS       T01001                                 
Symbol
NUP62, IBSN, SNDI, p62
Name
(RefSeq) nucleoporin 62
  KO
K14306  nuclear pore complex protein Nup62
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Disease
H01177  Infantile bilateral striatal necrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    23636 (NUP62)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    23636 (NUP62)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23636 (NUP62)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     23636 (NUP62)
SSDB
Motif
Pfam: Nsp1_C DUF4164 Exonuc_VII_L
Other DBs
NCBI-GeneID: 23636
NCBI-ProteinID: NP_001180286
OMIM: 605815
HGNC: 8066
Ensembl: ENSG00000213024
Vega: OTTHUMG00000183077
Pharos: P37198(Tbio)
UniProt: P37198 A0A024QZF1
Structure
LinkDB
Position
19:complement(49906825..49929504)
AA seq 522 aa
MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLF
SLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSN
LTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSA
QPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLC
TPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA
GIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA
WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGT
IYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNA
HMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagcgggtttaattttggaggcactggggcccctacaggcgggttcacgtttggcact
gcaaagacggcaacaaccacacctgctacagggttttctttctccacctctggcactgga
gggtttaattttggggctcccttccaaccagccacaagtaccccttccaccggcctgttc
tcacttgccacccagactccggccacacagacgacaggcttcacttttggaacagcgact
cttgcttcggggggaactggattttctttggggatcggtgcttcaaagctcaacttgagc
aacacagctgccaccccagccatggcaaaccccagcggctttgggctgggcagcagcaac
ctcactaatgccatatcgagcaccgtcacctccagccagggcacagcacccaccggcttt
gtgtttggcccctccaccacctctgtggctccagctaccacatctggaggcttctcattc
actggtggaagcacggcccaaccctccggtttcaacattggctcagcagggaattcagcc
cagcccacggcacctgccacgttgcccttcactccggccacgccagcagccaccacagca
ggtgccacacagccagctgctcccacacccacagccaccatcaccagcactgggcccagc
ctctttgcgtcaatagcaactgctccaacctcatctgccaccactggactctccctctgt
acccctgtgaccacagcgggcgcccccactgctgggacacagggcttcagcttaaaggca
cctggagcagcttccggcacctccacaacaacatccaccgctgccaccgccaccgccacc
accaccagcagcagcagcaccaccggctttgccttgaatttaaaaccactggcgccagcc
gggatccccagcaatacagcagctgccgtgaccgctccacctggccctggcgcagctgca
ggggcggctgccagctccgccatgacctacgcgcagctggagagcctgatcaacaaatgg
agcctggagctagaggaccaggagcggcacttcctccagcaggccacccaggtcaacgcc
tgggaccgcacgctgatcgagaatggagaaaagatcaccagcctgcaccgcgaggtggag
aaggtgaagctggaccagaagaggctggaccaggagctcgacttcatcctgtcccagcag
aaggagctggaagacctgctgagcccactggaggagttggtcaaggagcagagcgggacc
atctacctgcagcacgcggatgaggagcgtgagaaaacctacaagctggctgagaacatc
gatgcacagctcaagcgcatggcccaggatctcaaggacatcatcgagcacctgaacacg
tccggggcccccgccgacaccagtgacccactgcagcagatctgcaagatcctcaatgcg
cacatggactcactgcagtggatcgaccagaactcggccctgctgcagaggaaggtggag
gaggtgaccaaggtgtgcgagggccggcgcaaggagcaggagcgcagcttccggatcacc
tttgactga

DBGET integrated database retrieval system