KEGG   Homo sapiens (human): 24148
Entry
24148             CDS       T01001                                 
Symbol
PRPF6, ANT-1, ANT1, C20orf14, Prp6, RP60, SNRNP102, TOM, U5-102K, hPrp6
Name
(RefSeq) pre-mRNA processing factor 6
  KO
K12855  pre-mRNA-processing factor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    24148 (PRPF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    24148 (PRPF6)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    24148 (PRPF6)
 Complex C
   U5 SnRNP specific factors
    24148 (PRPF6)
SSDB
Motif
Pfam: PRP1_N TPR_14 TPR_19 TPR_17 TPR_2 Suf TPR_8 TPR_16 TPR_1 ChAPs EAD1
Other DBs
NCBI-GeneID: 24148
NCBI-ProteinID: NP_036601
OMIM: 613979
HGNC: 15860
Ensembl: ENSG00000101161
Pharos: O94906(Tbio)
UniProt: O94906
Structure
LinkDB
Position
20:63981132..64033100
AA seq 941 aa
MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQM
KKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERR
EQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLT
PVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM
RKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKS
VRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKA
VVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDAR
IMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT
QMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRK
HTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRA
VAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYER
ARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEE
QKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLW
LESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHD
PHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR
CESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF
NT seq 2826 nt   +upstreamnt  +downstreamnt
atgaacaagaagaagaaaccgttcctagggatgcccgcgcccctcggctacgtgccgggg
ctgggccggggcgccactggcttcaccacgcggtcagacattgggcccgcccgtgatgca
aatgaccctgtggatgatcgccatgcacccccaggcaagagaaccgttggggaccagatg
aagaaaaatcaggctgctgacgatgacgacgaggatctaaatgacaccaattacgatgag
tttaatggctatgctgggagcctcttctcaagtggaccctacgagaaagatgatgaggaa
gcagatgctatctatgcagccctggataaaaggatggatgaaagaagaaaagaaagacgg
gagcaaagggagaaagaagaaatagagaaatatcgtatggaacgccccaaaatccaacag
cagttctcagacctcaagaggaagttggcagaagtcacagaagaagagtggctgagcatc
cccgaggttggcgatgccagaaataaacgtcagcggaacccacgctatgagaagctgacc
cctgttcctgacagtttctttgccaaacatttacagaccggagagaaccatacctcagtg
gatccccgacaaactcaatttggaggtcttaacacaccctatccaggtggactaaacact
ccatacccaggtggaatgacgccaggactgatgacacctggcacaggtgagctggacatg
aggaagattggccaagcgaggaacactctgatggacatgaggctgagccaggtgtctgac
tccgtgagtggacagaccgtcgttgaccccaaaggctacctgacggatttaaattccatg
atcccgacacacggaggagacatcaatgatatcaagaaggcgcgactgctcctcaagtct
gttcgggagacgaaccctcatcacccgccagcctggattgcatcagcccgcctggaagaa
gtcactgggaagctacaagtagctcggaaccttatcatgaaggggacggagatgtgcccc
aagagtgaagatgtctggctggaagcagccaggttgcagcctggggacacagccaaggcc
gtggtagcccaagctgtccgtcatctcccacagtctgtcaggatttacatcagagccgca
gagctggaaacggacattcgtgcaaagaagcgggttcttcggaaagccctcgagcatgtt
ccaaactcggttcgcttgtggaaagcagccgttgagctggaagaacctgaagatgctaga
atcatgctgagccgagctgtggagtgctgccccaccagcgtggagctctggcttgctctg
gcaaggctggagacctatgaaaatgcccgcaaggtcttgaacaaggcgcgggagaacatt
cctacagaccgacatatctggatcacggctgctaagctggaggaagccaatgggaacacg
cagatggtggagaagatcatcgaccgagccatcacctcgctgcgggccaacggtgtggag
atcaaccgtgagcagtggatccaggatgccgaggaatgtgacagggctgggagtgtggcc
acctgccaggccgtcatgcgtgccgtgattgggattgggattgaggaggaagatcggaag
catacctggatggaggatgctgacagttgtgtagcccacaatgccctggagtgtgcacga
gccatctacgcctacgccctgcaggtgttccccagcaagaagagtgtgtggctgcgcgcc
gcgtacttcgagaagaaccatggcactcgggagtccctggaagcactcctgcagagggct
gtggcccactgccccaaagcagaggtgctgtggctcatgggcgccaagtccaagtggctg
gcaggggatgtgcctgcagcaaggagcatcctggccctggccttccaggccaaccccaac
agtgaggagatctggctggcagccgtgaagctggagtccgagaatgatgagtacgagcgg
gcccggaggctgctggccaaggcgcggagcagtgcccccaccgcccgggtgttcatgaag
tctgtgaagctggagtgggtgcaagacaacatcagggcagcccaagatctgtgcgaggag
gccctgcggcactatgaggacttccccaagctgtggatgatgaaggggcagatcgaggag
cagaaggagatgatggagaaggcgcgggaagcctataaccaggggttgaagaagtgtccc
cactccacacccctgtggcttttgctctctcggctggaggagaagattgggcagcttact
cgagcacgggccattttggaaaagtctcgtctgaagaacccaaagaaccctgggctgtgg
ttggagtccgtgcggctggagtaccgtgcggggctgaagaacatcgcaaatacactcatg
gccaaggcgctgcaggagtgccccaactccggtatcctgtggtctgaggccatcttcctc
gaggcaaggccccagaggaggaccaagagcgtggatgccctgaagaagtgtgagcatgac
ccccatgtgctcctggccgtggccaagctgttttggagtcagcggaagatcaccaaggcc
agggagtggttccaccgcactgtgaagattgactcggacctgggggatgcctgggccttc
ttctacaagtttgagctgcagcatggcactgaggagcagcaggaggaggtgaggaagcgc
tgtgagagtgcagagcctcggcatggggagctgtggtgcgccgtgtccaaggacatcgcc
aactggcagaagaagatcggggacatccttaggctggtggccggccgcatcaagaacacc
ttctga

DBGET integrated database retrieval system