KEGG   Homo sapiens (human): 248
Entry
248               CDS       T01001                                 
Symbol
ALPI, IAP
Name
(RefSeq) alkaline phosphatase, intestinal
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00730  Thiamine metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Drug target
Ilofotase alfa: D12277
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    248 (ALPI)
   00790 Folate biosynthesis
    248 (ALPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    248 (ALPI)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    248 (ALPI)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     248 (ALPI)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   248 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  248 (ALPI)
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme
Other DBs
NCBI-GeneID: 248
NCBI-ProteinID: NP_001622
OMIM: 171740
HGNC: 437
Ensembl: ENSG00000163295
Vega: OTTHUMG00000133258
Pharos: P09923(Tbio)
UniProt: P09923 A0A024R4A2
LinkDB
Position
2:232456153..232460753
AA seq 528 aa
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctgctgctgggcctgaggctacagctctccctgggcgtc
atcccagctgaggaggagaacccggccttctggaaccgccaggcagctgaggccctggat
gctgccaagaagctgcagcccatccagaaggtcgccaagaacctcatcctcttcctgggc
gatgggttgggggtgcccacggtgacagccaccaggatcctaaaggggcagaagaatggc
aaactggggcctgagacgcccctggccatggaccgcttcccatacctggctctgtccaag
acatacaatgtggacagacaggtgccagacagcgcagccacagccacggcctacctgtgc
ggggtcaaggccaacttccagaccatcggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgcggcaatgaggtcatctccgtgatgaaccgggccaagcaagcaggaaag
tcagtaggagtggtgaccaccacacgggtgcagcacgcctcgccagccggcacctacgca
cacacagtgaaccgcaactggtactcagatgctgacatgcctgcctcagcccgccaggag
gggtgccaggacatcgccactcagctcatctccaacatggacattgacgtgatccttggc
ggaggccgcaagtacatgtttcccatggggaccccagaccctgagtacccagctgatgcc
agccagaatggaatcaggctggacgggaagaacctggtgcaggaatggctggcaaagcac
cagggtgcctggtatgtgtggaaccgcactgagctcatgcaggcgtccctggaccagtct
gtgacccatctcatgggcctctttgagcccggagacacgaaatatgagatccaccgagac
cccacactggacccctccctgatggagatgacagaggctgccctgcgcctgctgagcagg
aacccccgcggcttctacctctttgtggagggcggccgcatcgaccatggtcatcatgag
ggtgtggcttaccaggcactcactgaggcggtcatgttcgacgacgccattgagagggcg
ggccagctcaccagcgaggaggacacgctgaccctcgtcaccgctgaccactcccatgtc
ttctcctttggtggctacaccttgcgagggagctccatcttcgggttggcccccagcaag
gctcaggacagcaaagcctacacgtccatcctgtacggcaatggcccgggctacgtgttc
aactcaggcgtgcgaccagacgtgaatgagagcgagagcgggagccccgattaccagcag
caggcggcggtgcccctgtcgtccgagacccacggaggcgaagacgtggcggtgtttgcg
cgcggcccgcaggcgcacctggtgcatggtgtgcaggagcagagcttcgtagcgcatgtc
atggccttcgctgcctgtctggagccctacacggcctgcgacctggcgcctcccgcctgc
accaccgacgccgcgcacccagttgccgcgtcgctgccactgctggccgggaccctgctg
ctgctgggggcgtccgctgctccctga

KEGG   Homo sapiens (human): 249
Entry
249               CDS       T01001                                 
Symbol
ALPL, AP-TNAP, APTNAP, HOPS, HPPA, HPPC, HPPI, HPPO, TNALP, TNAP, TNS-ALP, TNSALP
Name
(RefSeq) alkaline phosphatase, biomineralization associated
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00730  Thiamine metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Disease
H00213  Hypophosphatasia
Drug target
Asfotasealfa: D10595<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    249 (ALPL)
   00790 Folate biosynthesis
    249 (ALPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    249 (ALPL)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    249 (ALPL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     249 (ALPL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   249 (ALPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  249 (ALPL)
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme
Other DBs
NCBI-GeneID: 249
NCBI-ProteinID: NP_000469
OMIM: 171760
HGNC: 438
Ensembl: ENSG00000162551
Vega: OTTHUMG00000002949
Pharos: P05186(Tchem)
UniProt: P05186 A0A024RAB4
LinkDB
Position
1:21508984..21578410
AA seq 524 aa
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDE
KARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELN
RNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG
QAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYV
PHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALALYPLSVLF
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgatttcaccattcttagtactggccattggcacctgccttactaactccttagtgcca
gagaaagagaaagaccccaagtactggcgagaccaagcgcaagagacactgaaatatgcc
ctggagcttcagaagctcaacaccaacgtggctaagaatgtcatcatgttcctgggagat
gggatgggtgtctccacagtgacggctgcccgcatcctcaagggtcagctccaccacaac
cctggggaggagaccaggctggagatggacaagttccccttcgtggccctctccaagacg
tacaacaccaatgcccaggtccctgacagtgccggcaccgccaccgcctacctgtgtggg
gtgaaggccaatgagggcaccgtgggggtaagcgcagccactgagcgttcccggtgcaac
accacccaggggaacgaggtcacctccatcctgcgctgggccaaggacgctgggaaatct
gtgggcattgtgaccaccacgagagtgaaccatgccacccccagcgccgcctacgcccac
tcggctgaccgggactggtactcagacaacgagatgccccctgaggccttgagccagggc
tgtaaggacatcgcctaccagctcatgcataacatcagggacattgacgtgatcatgggg
ggtggccggaaatacatgtaccccaagaataaaactgatgtggagtatgagagtgacgag
aaagccaggggcacgaggctggacggcctggacctcgttgacacctggaagagcttcaaa
ccgagatacaagcactcccacttcatctggaaccgcacggaactcctgacccttgacccc
cacaatgtggactacctattgggtctcttcgagccaggggacatgcagtacgagctgaac
aggaacaacgtgacggacccgtcactctccgagatggtggtggtggccatccagatcctg
cggaagaaccccaaaggcttcttcttgctggtggaaggaggcagaattgaccacgggcac
catgaaggaaaagccaagcaggccctgcatgaggcggtggagatggaccgggccatcggg
caggcaggcagcttgacctcctcggaagacactctgaccgtggtcactgcggaccattcc
cacgtcttcacatttggtggatacaccccccgtggcaactctatctttggtctggccccc
atgctgagtgacacagacaagaagcccttcactgccatcctgtatggcaatgggcctggc
tacaaggtggtgggcggtgaacgagagaatgtctccatggtggactatgctcacaacaac
taccaggcgcagtctgctgtgcccctgcgccacgagacccacggcggggaggacgtggcc
gtcttctccaagggccccatggcgcacctgctgcacggcgtccacgagcagaactacgtc
ccccacgtgatggcgtatgcagcctgcatcggggccaacctcggccactgtgctcctgcc
agctcggcaggcagccttgctgcaggccccctgctgctcgcgctggccctctaccccctg
agcgtcctgttctga

KEGG   Homo sapiens (human): 250
Entry
250               CDS       T01001                                 
Symbol
ALPP, ALP, ALPI, IAP, PALP, PLAP, PLAP-1
Name
(RefSeq) alkaline phosphatase, placental
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00730  Thiamine metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    250 (ALPP)
   00790 Folate biosynthesis
    250 (ALPP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    250 (ALPP)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    250 (ALPP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     250 (ALPP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   250 (ALPP)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  250 (ALPP)
SSDB
Motif
Pfam: Alk_phosphatase Metalloenzyme
Other DBs
NCBI-GeneID: 250
NCBI-ProteinID: NP_001623
OMIM: 171800
HGNC: 439
Ensembl: ENSG00000163283
Vega: OTTHUMG00000133255
Pharos: P05187(Tbio)
UniProt: P05187 B2R7C7
Structure
LinkDB
Position
2:232378751..232382889
AA seq 535 aa
MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLII
FLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA
YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAG
TYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP
DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI
HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI
ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG
YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI
AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgctggggccctgcatgctgctgctgctgctgctgctgggcctgaggctacagctctcc
ctgggcatcatcccagttgaggaggagaacccggacttctggaaccgcgaggcagccgag
gccctgggtgccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatc
ttcctgggcgatgggatgggggtgtctacggtgacagctgccaggatcctaaaagggcag
aagaaggacaaactggggcctgagatacccctggccatggaccgcttcccatatgtggct
ctgtccaagacatacaatgtagacaaacatgtgccagacagtggagccacagccacggcc
tacctgtgcggggtcaagggcaacttccagaccattggcttgagtgcagccgcccgcttt
aaccagtgcaacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaa
gcagggaagtcagtgggagtggtaaccaccacacgagtgcagcacgcctcgccagccggc
acctacgcccacacggtgaaccgcaactggtactcggacgccgacgtgcctgcctccgcc
cgccaggaggggtgccaggacatcgctacgcagctcatctccaacatggacattgacgtg
atcctaggtggaggccgaaagtacatgtttcgcatgggaaccccagaccctgagtaccca
gatgactacagccaaggtgggaccaggctggacgggaagaatctggtgcaggaatggctg
gcgaagcgccagggtgcccggtatgtgtggaaccgcactgagctcatgcaggcttccctg
gacccgtctgtgacccatctcatgggtctctttgagcctggagacatgaaatacgagatc
caccgagactccacactggacccctccctgatggagatgacagaggctgccctgcgcctg
ctgagcaggaacccccgcggcttcttcctcttcgtggagggtggtcgcatcgaccatggt
catcatgaaagcagggcttaccgggcactgactgagacgatcatgttcgacgacgccatt
gagagggcgggccagctcaccagcgaggaggacacgctgagcctcgtcactgccgaccac
tcccacgtcttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcc
cctggcaaggcccgggacaggaaggcctacacggtcctcctatacggaaacggtccaggc
tatgtgctcaaggacggcgcccggccggatgttaccgagagcgagagcgggagccccgag
tatcggcagcagtcagcagtgcccctggacgaagagacccacgcaggcgaggacgtggcg
gtgttcgcgcgcggcccgcaggcgcacctggttcacggcgtgcaggagcagaccttcata
gcgcacgtcatggccttcgccgcctgcctggagccctacaccgcctgcgacctggcgccc
cccgccggcaccaccgacgccgcgcacccggggcggtccgtggtccccgcgttgcttcct
ctgctggccgggaccctgctgctgctggagacggccactgctccctga

KEGG   Homo sapiens (human): 251
Entry
251               CDS       T01001                                 
Symbol
ALPG, ALPPL, ALPPL2, GCAP
Name
(RefSeq) alkaline phosphatase, germ cell
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00730  Thiamine metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    251 (ALPG)
   00790 Folate biosynthesis
    251 (ALPG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    251 (ALPG)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    251 (ALPG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     251 (ALPG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   251 (ALPG)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  251 (ALPG)
SSDB
Motif
Pfam: Alk_phosphatase
Other DBs
NCBI-GeneID: 251
NCBI-ProteinID: NP_112603
OMIM: 171810
HGNC: 441
Ensembl: ENSG00000163286
Vega: OTTHUMG00000133257
Pharos: P10696(Tchem)
UniProt: P10696
LinkDB
Position
2:232406844..232410714
AA seq 532 aa
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctcctgctgggcctgaggctacagctctccctgggcatc
atcccagttgaggaggagaacccggacttctggaaccgccaggcagccgaggccctgggt
gccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatcttcctgggt
gacgggatgggggtgtctacggtgacagctgccaggatcctaaaagggcagaagaaggac
aaactggggcctgagaccttcctggccatggaccgcttcccgtacgtggctctgtccaag
acatacagtgtagacaagcatgtgccagacagtggagccacagccacggcctacctgtgc
ggggtcaagggcaacttccagaccattggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaagcaggaaag
tcagtgggagtggtaaccaccacacgggtgcagcatgcctcgccagccggcgcctacgcc
cacacggtgaaccgcaactggtactcggatgccgacgtgcctgcctcggcccgccaggag
gggtgccaggacatcgccacgcagctcatctccaacatggacattgatgtgatcctaggt
ggaggccgaaagtacatgtttcccatggggaccccagaccctgagtacccagatgactac
agccaaggtgggaccaggctggacgggaagaatctggtgcaggaatggctggcgaagcac
cagggtgcccggtacgtgtggaaccgcactgagctcctgcaggcttccctggacccgtct
gtgacccatctcatgggtctctttgagcctggagacatgaaatacgagatccaccgagac
tccacactggacccctccctgatggagatgacagaggctgccctgctcctgctgagcagg
aacccccgcggcttcttcctcttcgtggagggtggtcgcatcgaccatggtcatcatgaa
agcagggcttaccgggcactgactgagacgatcatgttcgacgacgccattgagagggcg
ggccagctcaccagcgaggaggacacgctgagcctcgtcactgccgaccactcccacgtc
ttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcccctggcaag
gcccgggacaggaaggcctacacggtcctcctatacggaaacggtccaggctatgtgctc
aaggacggcgcccggccggatgttacggagagcgagagcgggagccccgagtatcggcag
cagtcagcagtgcccctggacggagagacccacgcaggcgaggacgtggcggtgttcgcg
cgcggcccgcaggcgcacctggttcacggcgtgcaggagcagaccttcatagcgcacgtc
atggccttcgccgcctgcctggagccctacaccgcctgcgacctggcgccccgcgccggc
accaccgacgccgcgcacccggggccgtccgtggtccccgcgttgcttcctctgctggca
gggaccttgctgctgctggggacggccactgctccctga

DBGET integrated database retrieval system