KEGG   Homo sapiens (human): 25833
Entry
25833             CDS       T01001                                 
Symbol
POU2F3, Epoc-1, OCT-11, OCT11, OTF-11, PLA-1, PLA1, Skn-1a
Name
(RefSeq) POU class 2 homeobox 3
  KO
K09364  POU domain transcription factor, class 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    25833 (POU2F3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    25833 (POU2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    25833 (POU2F3)
   03021 Transcription machinery [BR:hsa03021]
    25833 (POU2F3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    25833 (POU2F3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     25833 (POU2F3)
SSDB
Motif
Pfam: Pou Homeodomain Homeobox_KN DUF4424 SprT-like
Other DBs
NCBI-GeneID: 25833
NCBI-ProteinID: NP_055167
OMIM: 607394
HGNC: 19864
Ensembl: ENSG00000137709
Vega: OTTHUMG00000166140
Pharos: Q9UKI9(Tbio)
UniProt: Q9UKI9
LinkDB
Position
11:120236638..120319945
AA seq 436 aa
MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSH
RPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQ
GLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSG
GADEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFK
NMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGRKRKKRTSIETNIRLTLEKRF
QDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPPVYNSRLVSPS
GSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSF
NSSGSWYRWNHSTYLH
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggtgaatctggagtccatgcacacagatatcaagatgagtggggatgtagccgattcc
acggatgctcgcagcactctcagccaggtggagccaggaaatgatcgaaatggcctagat
ttcaacaggcagattaaaaccgaagatctcagtgactccctgcagcagaccctctcccat
cggccatgccacctgagtcaaggacctgccatgatgtccggaaaccaaatgtctgggcta
aatgccagcccatgtcaggacatggcttccctccatccgctccagcagcttgtgctggtt
cccggccacttacagtctgtatcccagttcctgctatctcagacccagcctgggcagcaa
ggtctgcagccaaatctcctcccctttccacagcaacaaagcggtctcctcctcccacag
actgggccgggactggcatcccaggcatttgggcaccctgggctgccaggatcctcttta
gaaccccacctggaagcatcccagcatctcccagtgcccaagcatctacccagctctgga
ggggccgatgagcccagtgacctcgaggagctggagaagtttgccaagaccttcaagcag
aggcgcattaagctgggcttcacacagggagatgtggggctggcgatgggaaagctgtat
ggcaacgacttcagccagaccaccatctcacgatttgaggccctcaacctgagcttcaag
aacatgtgcaagctcaagcccctgctggagaagtggctgaatgatgcagagtcctctccg
tcagacccctcagtgagcacgcccagctcctaccccagcctcagtgaagtatttggtagg
aagagaaagaaacggaccagcatcgagaccaacatccgcctgactctggagaagaggttt
caagataacccaaaacccagctcggaggagatctccatgattgcagagcagttgtccatg
gagaaggaggtggtgagggtctggttctgcaaccgacgccaaaaggagaagcgaatcaac
tgccctgtggccacacccatcaaaccacctgtctacaactcccggctggtatctccctca
gggtctctgggccccctctctgtccctcctgtccacagtaccatgcctggaacagtaacg
tcatcctgttcccctgggaacaacagcaggccttcatctcctggctcaggactccacgcc
agcagccccactgcatctcaaaataactccaaagcagcagtgaactccgcctccagtttt
aactcttcaggatcttggtaccgatggaatcattccacctacctccactga

KEGG   Homo sapiens (human): 5451
Entry
5451              CDS       T01001                                 
Symbol
POU2F1, OCT1, OTF1, Oct1Z, oct-1B
Name
(RefSeq) POU class 2 homeobox 1
  KO
K09364  POU domain transcription factor, class 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
hsa05417  Lipid and atherosclerosis
Network
nt06140  Transcription (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00588  HSV VP16 to Oct-1-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    5451 (POU2F1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5451 (POU2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5451 (POU2F1)
   03021 Transcription machinery [BR:hsa03021]
    5451 (POU2F1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    5451 (POU2F1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     5451 (POU2F1)
SSDB
Motif
Pfam: POU2F1_C Pou Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 5451
NCBI-ProteinID: NP_001185712
OMIM: 164175
HGNC: 9212
Ensembl: ENSG00000143190
Vega: OTTHUMG00000034436
Pharos: P14859(Tbio)
UniProt: P14859
Structure
LinkDB
Position
1:167220885..167427345
AA seq 755 aa
MLDCSDYVLDSRMNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFL
GHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQ
ITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQ
PIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQL
PQQSQANLLQSQPSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEEL
EQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEK
WLNDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEE
ITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLV
TSSAATTLTVSPVLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSP
SASASTSEASSASETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANAS
LAAMAAAAGLNPSLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSL
PITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVAS
LHATSTSAESIQNSLFTVASASGAASTTTTASKAQ
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgctggactgcagtgactatgttctagactcaagaatgaacaatccgtcagaaaccagt
aaaccatctatggagagtggagatggcaacacaggcacacaaaccaatggtctggacttt
cagaagcagcctgtgcctgtaggaggagcaatctcaacagcccaggcgcaggctttcctt
ggacatctccatcaggtccaactcgctggaacaagtttacaggctgctgctcagtcttta
aatgtacagtctaaatctaatgaagaatcgggggattcgcagcagccaagccagccttcc
cagcagccttcagtgcaggcagccattccccagacccagcttatgctagctggaggacag
ataactgggcttactttgacgcctgcccagcaacagttactactccagcaggcacaggca
caggcacagctgctggctgctgcagtgcagcagcactccgccagccagcagcacagtgct
gctggagccaccatctccgcctctgctgccacgcccatgacgcagatccccctgtctcag
cccatacagatcgcacaggatcttcaacaactgcaacagcttcaacagcagaatctcaac
ctgcaacagtttgtgttggtgcatccaaccaccaatttgcagccagcgcagtttatcatc
tcacagacgccccagggccagcagggtctcctgcaagcgcaaaatcttctaacgcaacta
cctcagcaaagccaagccaacctcctacagtcgcagccaagcatcaccctcacctcccag
ccagcaaccccaacacgcacaatagcagcaaccccaattcagacacttccacagagccag
tcaacaccaaagcgaattgatactcccagcttggaggagcccagtgaccttgaggagctt
gagcagtttgccaagaccttcaaacaaagacgaatcaaacttggattcactcagggtgat
gttgggctcgctatggggaaactatatggaaatgacttcagccaaactaccatctctcga
tttgaagccttgaacctcagctttaagaacatgtgcaagttgaagccacttttagagaag
tggctaaatgatgcagagaacctctcatctgattcgtccctctccagcccaagtgccctg
aattctccaggaattgagggcttgagccgtaggaggaagaaacgcaccagcatagagacc
aacatccgtgtggccttagagaagagtttcttggagaatcaaaagcctacctcggaagag
atcactatgattgctgatcagctcaatatggaaaaagaggtgattcgtgtttggttctgt
aaccgccgccagaaagaaaaaagaatcaacccaccaagcagtggtgggaccagcagctca
cctattaaagcaattttccccagcccaacttcactggtggcgaccacaccaagccttgtg
actagcagtgcagcaactaccctcacagtcagccctgtcctccctctgaccagtgctgct
gtgacgaatctttcagttacaggcacttcagacaccacctccaacaacacagcaaccgtg
atttccacagcgcctccagcttcctcagcagtcacgtccccctctctgagtccctcccct
tctgcctcagcctccacctccgaggcatccagtgccagtgagaccagcacaacacagacc
acctccactcctttgtcctcccctcttgggaccagccaggtgatggtgacagcatcaggt
ttgcaaacagcagcagctgctgcccttcaaggagctgcacagttgccagcaaatgccagt
cttgctgccatggcagctgctgcaggactaaacccaagcctgatggcaccctcacagttt
gcggctggaggtgccttactcagtctgaatccagggaccctgagcggtgctctcagccca
gctctaatgagcaacagtacactggcaactattcaagctcttgcttctggtggctctctt
ccaataacatcacttgatgcaactgggaacctggtatttgccaatgcgggaggagccccc
aacatcgtgactgcccctctgttcctgaaccctcagaacctctctctgctcaccagcaac
cctgttagcttggtctctgccgccgcagcatctgcagggaactctgcacctgtagccagc
cttcacgccacctccacctctgctgagtccatccagaactctctcttcacagtggcctct
gccagcggggctgcgtccaccaccaccaccgcctccaaggcacagtga

KEGG   Homo sapiens (human): 5452
Entry
5452              CDS       T01001                                 
Symbol
POU2F2, OCT2, OTF2, Oct-2
Name
(RefSeq) POU class 2 homeobox 2
  KO
K09364  POU domain transcription factor, class 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    5452 (POU2F2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5452 (POU2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5452 (POU2F2)
   03021 Transcription machinery [BR:hsa03021]
    5452 (POU2F2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain POU
    5452 (POU2F2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    Octamer transcription factors
     5452 (POU2F2)
SSDB
Motif
Pfam: Pou Homeodomain
Other DBs
NCBI-GeneID: 5452
NCBI-ProteinID: NP_001193954
OMIM: 164176
HGNC: 9213
Ensembl: ENSG00000028277
Vega: OTTHUMG00000165991
Pharos: P09086(Tbio)
UniProt: P09086
Structure
LinkDB
Position
19:complement(42086110..42197936)
AA seq 479 aa
MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPS
TKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL
QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLS
HPQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTT
ISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKK
RTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSA
APMLPSPGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGG
GGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggttcactccagcatgggggctccagaaataagaatgtctaagcccctggaggccgag
aagcaaggtctggactccccatcagagcacacagacaccgaaagaaatggaccagacact
aatcatcagaacccccaaaataagacctccccattctccgtgtccccaactggccccagt
acaaagatcaaggctgaagaccccagtggcgattcagccccagcagcacccctgccccct
cagccggcccagcctcatctgccccaggcccaactcatgttgacgggcagccagctagct
ggggacatacagcagctcctccagctccagcagctggtgcttgtgccaggccaccacctc
cagccacctgctcagttcctgctaccgcaggcccagcagagccagccaggcctgctaccg
acaccaaatctattccagctacctcagcaaacccagggagctcttctgacctcccagccc
cgggccgggcttcccacacaggccgtgacccgccctacgctgcccgacccgcacctctcg
cacccgcagccccccaaatgcttggagccaccatcccaccccgaggagcccagtgatctg
gaggagctggagcaattcgcccgcaccttcaagcaacgccgcatcaagctgggcttcacg
cagggtgatgtgggcctggccatgggcaagctctacggcaacgacttcagccagacgacc
atttcccgcttcgaggccctcaacctgagcttcaagaacatgtgcaaactcaagcccctc
ctggagaagtggctcaacgatgcagagactatgtctgtggactcaagcctgcccagcccc
aaccagctgagcagccccagcctgggtttcgacggcctgcccggccggagacgcaagaag
aggaccagcatcgagacaaacgtccgcttcgccttagagaagagttttctagcgaaccag
aagcctacctcagaggagatcctgctgatcgccgagcagctgcacatggagaaggaagtg
atccgcgtctggttctgcaaccggcgccagaaggagaaacgcatcaacccctgcagtgcg
gcccccatgctgcccagcccagggaagccggccagctacagcccccatatggtcacaccc
caagggggcgcggggaccttaccgttgtcccaagcttccagcagtctgagcacaacagtt
actaccttatcctcagctgtggggacgctccaccccagccggacagctggagggggtggg
ggcgggggcggggctgcgccccccctcaattccatcccctctgtcactcccccacccccg
gccaccaccaacagcacaaaccccagccctcaaggcagccactcggctatcggcttgtca
ggcctgaaccccagcacgggccctggcctctggtggaaccctgccccttaccagccttga

DBGET integrated database retrieval system