KEGG   Homo sapiens (human): 25906
Entry
25906             CDS       T01001                                 
Symbol
ANAPC15, APC15, C11orf51, HSPC020
Name
(RefSeq) anaphase promoting complex subunit 15
  KO
K25228  anaphase-promoting complex subunit 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    25906 (ANAPC15)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25906 (ANAPC15)
   04114 Oocyte meiosis
    25906 (ANAPC15)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    25906 (ANAPC15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    25906 (ANAPC15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    25906 (ANAPC15)
   03036 Chromosome and associated proteins [BR:hsa03036]
    25906 (ANAPC15)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     25906 (ANAPC15)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    25906 (ANAPC15)
SSDB
Motif
Pfam: ANAPC15 RNA_pol_Rpc4 DUF2457 V_ATPase_I
Other DBs
NCBI-GeneID: 25906
NCBI-ProteinID: NP_001265416
OMIM: 614717
HGNC: 24531
Ensembl: ENSG00000110200
Pharos: P60006(Tdark)
UniProt: P60006 A0A024R5G0
Structure
LinkDB
Position
11:complement(72106372..72112780)
AA seq 121 aa
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASE
HYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWM
I
NT seq 366 nt   +upstreamnt  +downstreamnt
atgtccactttgttcccctcactcttccctcgtgtgactgagactctgtggtttaatctg
gatcgaccctgtgtggaagagacagagctgcagcagcaggaacagcagcatcaggcctgg
ctccaaagcatcgcggagaaagacaacaacctggttcctattggcaagccagcctcagag
cactatgatgacgaggaagaagaggatgatgaagatgatgaggatagtgaagaggactca
gaggatgatgaggatatgcaggacatggacgagatgaatgactacaatgagtcaccggat
gatggagaggtcaatgaggtggacatggaaggcaacgaacaggatcaggaccagtggatg
atctag

DBGET integrated database retrieval system