KEGG   Homo sapiens (human): 26121
Entry
26121             CDS       T01001                                 
Symbol
PRPF31, NY-BR-99, PRP31, RP11, SNRNP61
Name
(RefSeq) pre-mRNA processing factor 31
  KO
K12844  U4/U6 small nuclear ribonucleoprotein PRP31
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    26121 (PRPF31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    26121 (PRPF31)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    26121 (PRPF31)
SSDB
Motif
Pfam: Nop Prp31_C VWA_CoxE Peptidase_S66
Other DBs
NCBI-GeneID: 26121
NCBI-ProteinID: NP_056444
OMIM: 606419
HGNC: 15446
Ensembl: ENSG00000105618
Pharos: Q8WWY3(Tbio)
UniProt: Q8WWY3
Structure
LinkDB
Position
19:54115754..54131713
AA seq 499 aa
MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMF
AEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSK
RFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLS
EEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTN
LSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCT
LAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYR
KMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARI
SKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYF
SSMAEFLKVKGEKSGLMST
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgtctctggcagatgagctcttagctgatctcgaagaggcagcagaagaggaggaagga
ggaagctatggggaggaagaagaggagccagcgatcgaggatgtgcaggaggagacacag
ctggatctttccggggattcagtcaagaccatcgccaagctatgggatagtaagatgttt
gctgagattatgatgaagattgaggagtatatcagcaagcaagccaaagcttcagaagtg
atgggaccagtggaggccgcgcctgaataccgcgtcatcgtggatgccaacaacctgacc
gtggagatcgaaaacgagctgaacatcatccataagttcatccgggataagtactcaaag
agattccctgaactggagtccttggtccccaatgcactggattacatccgcacggtcaag
gagctgggcaacagcctggacaagtgcaagaacaatgagaacctgcagcagatcctcacc
aatgccaccatcatggtcgtcagcgtcaccgcctccaccacccaggggcagcagctgtcg
gaggaggagctggagcggctggaggaggcctgcgacatggcgctggagctgaacgcctcc
aagcaccgcatctacgagtatgtggagtcccggatgtccttcatcgcacccaacctgtcc
atcattatcggggcatccacggccgccaagatcatgggtgtggccggcggcctgaccaac
ctctccaagatgcccgcctgcaacatcatgctgctcggggcccagcgcaagacgctgtcg
ggcttctcgtctacctcagtgctgccccacaccggctacatctaccacagtgacatcgtg
cagtccctgccaccggatctgcggcggaaagcggcccggctggtggccgccaagtgcaca
ctggcagcccgtgtggacagtttccacgagagcacagaagggaaggtgggctacgaactg
aaggatgagatcgagcgcaaattcgacaagtggcaggagccgccgcctgtgaagcaggtg
aagccgctgcctgcgcccctggatggacagcggaagaagcgaggcggccgcaggtaccgc
aagatgaaggagcggctggggctgacggagatccggaagcaggccaaccgtatgagcttc
ggagagatcgaggaggacgcctaccaggaggacctgggattcagcctgggccacctgggc
aagtcgggcagtgggcgtgtgcggcagacacaggtaaacgaggccaccaaggccaggatc
tccaagacgctgcagcggaccctgcagaagcagagcgtcgtatatggcgggaagtccacc
atccgcgaccgctcctcgggcacggcctccagcgtggccttcaccccactccagggcctg
gagattgtgaacccacaggcggcagagaagaaggtggctgaggccaaccagaagtatttc
tccagcatggctgagttcctcaaggtcaagggcgagaagagtggccttatgtccacctga

DBGET integrated database retrieval system