KEGG   Homo sapiens (human): 2621
Entry
2621              CDS       T01001                                 

Gene name
GAS6, AXLLG, AXSF
Definition
(RefSeq) growth arrest specific 6
  KO
K05464  growth arrest-specific 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    2621 (GAS6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2621 (GAS6)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2621 (GAS6)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 EGF_CA Gla cEGF FXa_inhibition EGF hEGF EGF_3 Plasmod_Pvs28
Other DBs
NCBI-GeneID: 2621
NCBI-ProteinID: NP_000811
OMIM: 600441
HGNC: 4168
Ensembl: ENSG00000183087
Vega: OTTHUMG00000017395
Pharos: Q14393(Tbio)
UniProt: Q14393
LinkDB
Structure
PDB: 
5VXZ 4RA0 2C5D 1H30

Position
13q34
AA seq 678 aa
MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGH
LERECVEELCSREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQC
TPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHC
SCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVD
ECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKSLYLGRM
FSGTPVIRLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLR
YNGVGRVTSSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLN
LTVGGIPFHEKDLVQPINPRLDGCMRSWNWLNGEDTTIQETVKVNTRMQCFSVTERGSFY
PGSGFAFYSLDYMRTPLDVGTESTWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALV
DYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVS
AAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAY
KHSDITAHSCPPVEPAAA
NT seq 2037 nt   +upstreamnt  +downstreamnt
atggccccttcgctctcgcccgggcccgccgccctgcgccgcgcgccgcagctgctgctg
ctgctgctggccgcggagtgcgcgcttgccgcgctgttgccggcgcgcgaggccacgcag
ttcctgcggcccaggcagcgccgcgcctttcaggtcttcgaggaggccaagcagggccac
ctggagagggagtgcgtggaggagctgtgcagccgcgaggaggcgcgggaggtgttcgag
aacgaccccgagacggattatttttacccaagatacttagactgcatcaacaagtatggg
tctccgtacaccaaaaactcaggcttcgccacctgcgtgcaaaacctgcctgaccagtgc
acgcccaacccctgcgataggaaggggacccaagcctgccaggacctcatgggcaacttc
ttctgcctgtgtaaagctggctgggggggccggctctgcgacaaagatgtcaacgaatgc
agccaggagaacgggggctgcctccagatctgccacaacaagccgggtagcttccactgt
tcctgccacagcggcttcgagctctcctctgatggcaggacctgccaagacatagacgag
tgcgcagactcggaggcctgcggggaggcgcgctgcaagaacctgcccggctcctactcc
tgcctctgtgacgagggctttgcgtacagctcccaggagaaggcttgccgagatgtggac
gagtgtctgcagggccgctgtgagcaggtctgcgtgaactccccagggagctacacctgc
cactgtgacgggcgtgggggcctcaagctgtcccaggacatggacacctgtgaggacatc
ttgccgtgcgtgcccttcagcgtggccaagagtgtgaagtccttgtacctgggccggatg
ttcagtgggacccccgtgatccgactgcgcttcaagaggctgcagcccaccaggctggta
gctgagtttgacttccggacctttgaccccgagggcatcctcctctttgccggaggccac
caggacagcacctggatcgtgctggccctgagagccggccggctggagctgcagctgcgc
tacaacggtgtcggccgtgtcaccagcagcggcccggtcatcaaccatggcatgtggcag
acaatctctgttgaggagctggcgcggaatctggtcatcaaggtcaacagggatgctgtc
atgaaaatcgcggtggccggggacttgttccaaccggagcgaggactgtatcatctgaac
ctgaccgtgggaggtattcccttccatgagaaggacctcgtgcagcctataaaccctcgt
ctggatggctgcatgaggagctggaactggctgaacggagaagacaccaccatccaggaa
acggtgaaagtgaacacgaggatgcagtgcttctcggtgacggagagaggctctttctac
cccgggagcggcttcgccttctacagcctggactacatgcggacccctctggacgtcggg
actgaatcaacctgggaagtagaagtcgtggctcacatccgcccagccgcagacacaggc
gtgctgtttgcgctctgggcccccgacctccgtgccgtgcctctctctgtggcactggta
gactatcactccacgaagaaactcaagaagcagctggtggtcctggccgtggagcatacg
gccttggccctaatggagatcaaggtctgcgacggccaagagcacgtggtcaccgtctcg
ctgagggacggtgaggccaccctggaggtggacggcaccaggggccagagcgaggtgagc
gccgcgcagctgcaggagaggctggccgtgctcgagaggcacctgcggagccccgtgctc
acctttgctggcggcctgccagatgtgccggtgacttcagcgccagtcaccgcgttctac
cgcggctgcatgacactggaggtcaaccggaggctgctggacctggacgaggcggcgtac
aagcacagcgacatcacggcccactcctgcccccccgtggagcccgccgcagcctag

DBGET integrated database retrieval system