KEGG   Homo sapiens (human): 26249
Entry
26249             CDS       T01001                                 
Symbol
KLHL3, PHA2D
Name
(RefSeq) kelch like family member 3
  KO
K10443  kelch-like protein 2/3
Organism
hsa  Homo sapiens (human)
Disease
H00243  Hyperkalemic distal renal tubular acidosis (RTA type 4)
H02310  Renal tubular acidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26249 (KLHL3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     26249 (KLHL3)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK BTB Kelch_3 Kelch_2 Kelch_4 Skp1_POZ SANBR_BTB
Other DBs
NCBI-GeneID: 26249
NCBI-ProteinID: NP_059111
OMIM: 605775
HGNC: 6354
Ensembl: ENSG00000146021
Pharos: Q9UH77(Tbio)
UniProt: Q9UH77
Structure
LinkDB
Position
5:complement(137617500..137736089)
AA seq 587 aa
MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVE
IEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENV
QVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFP
EVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVR
LPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTPVSLP
KVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVYAVGGFNGSLR
VRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNE
WFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRR
SGAGVGVLSGQLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLY
VVGGDDGSCNLASVEYYNPVTDKWTLLPTNMSTGRSYAGVAVIHKSL
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggagggtgaaagtgtcaagctgagctcccagactctgatacaggctggggatgatgag
aagaaccagaggacgatcactgtcaaccctgcccacatggggaaagcattcaaggttatg
aatgaactgcggagtaaacagctgttgtgtgacgtgatgattgtggcagaagatgtcgag
atagaagcccaccgtgtggtcctggcagcctgcagcccctacttctgtgcgatgttcaca
ggtgacatgtctgagagtaaagccaaaaagatagaaatcaaggacgtggatgggcagacg
ctgagtaagctgattgactacatctatactgctgaaatcgaggtgactgaagagaatgtc
caggtgctgctcccggcagccagcttgctgcagctcatggatgttcggcagaactgctgt
gacttcctgcagtctcagttgcatcccaccaattgcctgggcatccgtgcatttgcagat
gtacacacctgcactgaccttctgcagcaggccaatgcctacgcagagcagcactttcca
gaggtgatgctaggagaagaatttcttagcctgagtctggaccaggtgtgcagcttgata
tccagcgacaagctgaccgtttcttcagaagagaaggtgtttgaagctgtgatctcatgg
atcaattatgagaaagaaacccgtttagagcacatggcaaagctgatggaacatgtccga
cttcctctcttacctagggactacctagtccaaacggttgaagaagaagctttgataaag
aataacaacacctgtaaagacttcctcattgaggccatgaaataccatctcctccctctg
gatcagagactattgattaagaacccaaggaccaagcccaggactccagtcagccttccc
aaggtcatgattgtggttggcggccaggcacccaaggcaatccgcagtgtggagtgctat
gatttcgaggaggaccggtgggatcagattgctgagcttccttccagaagatgcagagca
ggtgtggtgttcatggctggccacgtgtatgccgtgggagggtttaatggctcactgcgg
gtgcggacagtggatgtgtatgacggcgtgaaggaccagtggacgtccattgccagcatg
caggagcgccggagcacactgggcgcagcggtgctcaatgacttgctctacgcagtggga
ggctttgatggcagtactggcctagcatcggtggaagcctacagctacaagaccaacgag
tggttctttgtggccccgatgaacacgcggcggagcagtgtgggtgtgggcgttgtggag
gggaagctatatgctgttgggggttatgatggagcttcccgccagtgtctgagcactgtg
gagcagtacaacccagcgaccaatgaatggatatacgtggcggacatgagcacccgccgc
agtggcgcaggggttggagtgcttagcggacagctgtacgccacaggtgggcatgatggg
cctttggtgaggaagagcgttgaggtttacgatcctggaacaaatacctggaagcaagtg
gcagacatgaacatgtgccggcgcaacgcaggggtctgtgcagtaaatgggctcctgtat
gtggttggaggggatgatggatcctgcaacttggcttcggtggagtactacaatcctgtc
actgacaaatggacgctgcttccaacgaacatgagcacggggcggagctatgcaggtgtt
gccgtgattcacaagtccttgtga

DBGET integrated database retrieval system