Homo sapiens (human): 26285 Help Entry 26285             CDS       T01001                                  Symbol CLDN17 Name (RefSeq) claudin-17   KO K06087   claudin Organism hsa  Homo sapiens (human) Pathway hsa03272   Virion - Hepatitis viruses hsa04382   Cornified envelope formation hsa04514   Cell adhesion molecule (CAM) interaction hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa05130   Pathogenic Escherichia coli infection hsa05160   Hepatitis C Network nt06180  Pathogenic Escherichia coli   Element N01287   Tight junction-Actin signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     26285 (CLDN17)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     26285 (CLDN17)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     26285 (CLDN17)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     26285 (CLDN17)   09158 Development and regeneration    04382 Cornified envelope formation     26285 (CLDN17)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     26285 (CLDN17)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     26285 (CLDN17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     26285 (CLDN17)    04147 Exosome [BR:hsa04147]     26285 (CLDN17) Cilium and associated proteins [BR:hsa03037]  Other cilia and associated proteins   Stereociliary proteins    26285 (CLDN17) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    26285 (CLDN17)   Exosomal proteins of colorectal cancer cells    26285 (CLDN17) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 CdpA_N Clc-like DNER_C DUF4064 Claudin_3 Motif Other DBs NCBI-GeneID:  26285 NCBI-ProteinID:  NP_036263 OMIM:  617005 HGNC:  2038 Ensembl:  ENSP00000286808.3 UniProt:  P56750 LinkDB All DBs Position 21:complement(30165565..30166805) Genome browser AA seq 224 aa AA seqDB search MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARV RLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLG TSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGG LLCGFCCCNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV NT seq 675 nt NT seq  +upstreamnt  +downstreamnt atggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtgggg actcttgccacaacccttctgcctcagtggagagtatcagcttttgttggcagcaacatt attgtctttgagaggctctgggaagggctctggatgaattgcatccgacaagccagggtc cggttgcaatgcaagttctatagctccttgttggctctcccgcctgccctggaaacagcc cgggccctcatgtgtgtggctgttgctctctccttgatcgccctgcttattggcatctgt ggcatgaagcaggtccagtgcacaggctctaacgagagggccaaagcataccttctggga acttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggaca gccaatataatcatcagagatttctacaacccagccatccacataggtcagaaacgagag ctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggagggggt ctgctttgtggattttgctgctgcaacagaaagaagcaagggtacagatatccagtgcct ggctaccgtgtgccacacacagataagcgaagaaatacgacaatgcttagtaagacctcc accagttatgtctaa

DBGET integrated database retrieval system