KEGG   Homo sapiens (human): 26873
Entry
26873             CDS       T01001                                 
Symbol
OPLAH, 5-Opase, OPLA, OPLAHD
Name
(RefSeq) 5-oxoprolinase, ATP-hydrolysing
  KO
K01469  5-oxoprolinase (ATP-hydrolysing) [EC:3.5.2.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
N00900  GPX1 deficiency in glutathione biosynthesis
N00901  GSS deficiency in glutathione biosynthesis
N00902  GCLC deficiency in glutathione biosynthesis
N00903  OPLAH deficiency in glutathione biosynthesis
Disease
H02313  5-Oxoprolinase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    26873 (OPLAH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.9  5-oxoprolinase (ATP-hydrolysing)
     26873 (OPLAH)
SSDB
Motif
Pfam: Hydantoinase_B Hydantoinase_A Hydant_A_N Hydant_A_C
Other DBs
NCBI-GeneID: 26873
NCBI-ProteinID: NP_060040
OMIM: 614243
HGNC: 8149
Ensembl: ENSG00000178814
Vega: OTTHUMG00000165435
Pharos: O14841(Tdark)
UniProt: O14841
LinkDB
Position
8:complement(144050322..144063961)
AA seq 1288 aa
MGSPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQEAG
MLLPRDQPLDSSHIASIRMGTTVATNALLERKGERVALLVTRGFRDLLHIGTQARGDLFD
LAVPMPEVLYEEVLEVDERVVLHRGEAGTGTPVKGRTGDLLEVQQPVDLGALRGKLEGLL
SRGIRSLAVVLMHSYTWAQHEQQVGVLARELGFTHVSLSSEAMPMVRIVPRGHTACADAY
LTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSAT
TYQQEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRL
FFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGENQPLSP
EASRKALEAVATEVNSFLTNGPCPASPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDP
SAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLLYA
PETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPATA
RSPRAGDFGAAFVERYMREFGFVIPERPVVVDDVRVRGTGRSGLRLEDAPKAQTGPPRVD
KMTQCYFEGGYQETPVYLLAELGYGHKLHGPCLIIDSNSTILVEPGCQAEVTKTGDICIS
VGAEVPGTVGPQLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDG
GLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW
PGQTRPVFYVASRGHHADIGGITPGSMPPHSTMLQQEGAVFLSFKLVQGGVFQEEAVTEA
LRAPGKVPNCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANA
ELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVFDFSGTGPEV
FGNLNAPRAVTLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPRGSILDPSPEAAVVGGNV
LTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPSWHGRSGVHSHM
TNTRITDPEILESRYPVILRRFELRRGSGGRGRFRGGDGVTRELLFREEALLSVLTERRA
FRPYGLHGGEPGARGLNLLIRKNGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPEDPA
PPPGSPPQALAFPEHGSVYEYRRAQEAV
NT seq 3867 nt   +upstreamnt  +downstreamnt
atgggcagccccgagggccgcttccactttgccatcgaccgtgggggtaccttcacagac
gtctttgcccagtgcccaggggggcacgtgcgggtcttaaaactgctctcagaggaccct
gccaactatgcggacgcgccaaccgaaggcatccgccgcatcctggagcaggaggccggc
atgctcctgccccgggaccagccgctggactccagtcatatcgccagcatccgcatgggc
accacagtggccaccaacgcactgctggagcggaagggggagcgggtggcgctgctggtg
acacgtggcttccgagacctgctgcacattggcacccaagcccgtggggacctctttgac
ctggccgtgcccatgcctgaggtgctgtatgaagaggtgctggaggtggacgaacgcgtg
gtgctgcaccgtggagaggcgggcaccgggacgcctgtgaaaggccgcacgggggacctg
ctggaagtgcagcagcctgtggacctgggggccctgcgtgggaagctggaggggctgcta
tctcgaggcatccgcagcctggctgtggtgctcatgcactcgtacacgtgggcccagcat
gagcagcaggtgggtgtgctggcccgggagctgggcttcacgcacgtgtcactgtcctcg
gaggccatgcccatggtgcgcatcgtccctcgggggcacacggcctgtgccgacgcctac
ctcacgcccgccatccagcgctacgtgcagggcttctgccgtggcttccagggccaactc
aaggatgtgcaggtgttgttcatgcgctccgatggcggcctggcgcccatggacaccttc
agcggctccagtgctgtgctctcgggcccggccggcggcgtggtgggctactcagccacc
acctaccagcaggagggtggccagcctgtcatcggctttgacatgggaggcacgtccacg
gatgtgagccgctatgctggggaattcgagcacgtcttcgaggccagcacagctggcgtc
accctccaggccccgcagctggacatcaacaccgtggcagcgggagggggttcccgcctc
ttcttcaggtctggcctctttgtggttgggcccgagtcagcaggagcccacccaggaccc
gcctgctaccgcaaagggggccctgtgacagtgacggatgctaatctggtcctgggtcgc
ctgctgcctgcctccttcccctgcatttttgggccgggagagaaccaaccactttcccct
gaggcctcccgcaaagccctggaggctgtggccactgaggtcaacagcttcctgaccaac
gggccctgcccggcctccccgctgagcctggaggaggtggccatggggttcgtgcgcgtg
gccaacgaggccatgtgccggcccatccgtgcactcacgcaggcaagaggccatgacccc
tcagcccatgtgctggcctgctttgggggagctggtgggcagcatgcatgtgccatcgcc
cgggccctgggcatggacacggtgcacatccacaggcacagtgggctgctgtcggccctg
gggctggccctggctgacgtggtgcatgaggcacaggaaccctgctccctgctctacgcg
cctgagaccttcgtgcagctggaccagaggctgagccgcctggaggagcagtgtgtggat
gctctgcaggcccagggcttccccaggtcccagatcagcactgagagcttcctgcacctg
cgctaccagggcacggactgtgctctgatggtgtctgcccaccagcacccagccacagcc
cgctcgccccgtgcgggggacttcggggcagcctttgtggagcggtacatgagggagttt
ggctttgtcatacctgagcggccggtggtcgtggacgatgtgcgagtgcggggcaccggc
cgcagtggtcttcgcctcgaggatgcccccaaagcccagaccgggcctccccgggtggac
aagatgacccagtgctactttgaggggggctaccaggagacccctgtgtacctgctggca
gagctgggctatgggcacaagctccatgggccctgcctcatcatcgacagtaacagcacc
atcctggtggagccaggttgccaggcagaggtgaccaagacaggggacatctgcatctcc
gtgggggccgaagtccccggcacagtgggcccccagctggaccctatccagctgtccatc
ttctcacaccgcttcatgagcattgctgagcagatgggccgcatcctgcagcgcacagcc
atctccaccaacatcaaggagcgtctggacttctcctgtgccctctttgggcccgatggg
gggctggtgtccaatgccccccacatccctgtgcacctgggtgccatgcaggagacggtg
cagttccagattcagcacctgggggccgatctccaccctggcgacgtgctactgagcaac
catcccagtgccgggggcagccacctgccagacctgactgttatcacaccggtgttttgg
ccgggtcagacgcggcctgtgttctatgtggccagccgagggcaccacgcagacatcggg
ggcatcacaccaggctccatgcccccccactccaccatgctgcaacaggagggtgccgtc
tttctgtccttcaaacttgtccaggggggcgtcttccaggaggaggcggtgacggaggcc
ctgcgggcgccaggcaaggtccccaactgcagcggaaccagaaacctgcacgacaacctg
tcggacctccgtgcccaggtggcagccaaccagaagggcatccagctggtgggggagctc
attgggcagtacggcctggacgtggtgcaggcctacatgggccatattcaggcaaacgct
gagctggccgtgcgagacatgttgcgtgcctttggaacctcccggcaggcccggggcctg
cccctggaggtgtcctcggaagaccacatggacgacggttcccccatccgcctccgtgtg
cagatcagcctgagtcagggcagcgccgtgtttgacttcagcggcactgggccggaggtg
tttggtaatctcaacgcaccgcgggccgtaaccctgtccgccctcatctactgcctgcgc
tgtctggtgggccgcgacatcccactcaaccagggctgcctggcgccagtgcgcgtggtc
attccccgaggctccatcctggacccgtcgcccgaggcggcggtggtgggcggcaacgtg
ctcacgtcgcagcgcgtggtggatgtcatcctgggggcctttggggcctgcgccgcctcc
cagggctgcatgaacaacgtgaccctgggcaacgcccacatgggctactacgagacggtg
gcgggcggcgcgggcgcgggtcccagctggcacgggcgcagcggtgtgcacagccacatg
accaacacacgcatcaccgaccctgagatcctggagagccggtacccggtcatcctgcgc
cgcttcgagctgcggcggggctcggggggcagaggccgcttccgaggcggcgacggcgtc
acccgcgagctgctctttcgtgaggaggcgctgctgtcagtgctgaccgagcgccgcgcc
ttccggccatacgggctccacgggggcgagcctggcgcccgcggcctaaacctgctgatc
cgcaaaaacggccggacggtgaatctgggcggcaagacgtcggtgaccgtgtaccccggg
gatgtgttctgtctccacacgcccggcggcggtggctatggggacccggaggaccccgcc
ccaccgccggggtcgcccccgcaagcactggcctttcccgagcacggcagcgtctatgag
tatcgccgggcccaggaggccgtgtga

DBGET integrated database retrieval system