KEGG   Homo sapiens (human): 27085
Entry
27085             CDS       T01001                                 
Symbol
MTBP, MDM2BP
Name
(RefSeq) MDM2 binding protein
  KO
K26116  Mdm2-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Network
nt06509  DNA replication
  Element
N01468  DNA replication licensing
N01470  Pre-IC formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    27085 (MTBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    27085 (MTBP)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    27085 (MTBP)
SSDB
Motif
Pfam: MTBP_mid MTBP_C MTBP_N
Other DBs
NCBI-GeneID: 27085
NCBI-ProteinID: NP_071328
OMIM: 605927
HGNC: 7417
Ensembl: ENSG00000172167
UniProt: Q96DY7
LinkDB
Position
8:120445419..120523636
AA seq 904 aa
MDRYLLLVIWGEGKFPSAASREAEHGPEVSSGEGTENQPDFTAANVYHLLKRSISASINP
EDSTFPACSVGGIPGSKKWFFAVQAIYGFYQFCSSDWQEIHFDTEKDKIEDVLQTNIEEC
LGAVECFEEEDSNSRESLSLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKL
KDYLPTVGALKHLREWYSAKITIAGNHCEINCQKIAEYLSANVVSLEDLRNVIDSKELWR
GKIQIWERKFGFEISFPEFCLKGVTLKNFSTSNLNTDFLAKKIIPSKDKNILPKVFHYYG
PALEFVQMIKLSDLPSCYMSDIEFELGLTNSTKQNSVLLLEQISSLCSKVGALFVLPCTI
SNILIPPPNQLSSRKWKEYIAKKPKTISVPDVEVKGECSSYYLLLQGNGNRRCKATLIHS
ANQINGSFALNLIHGKMKTKTEEAKLSFPFDLLSLPHFSGEQIVQREKQLANVQVLALEE
CLKRRKLAKQPETVSVAELKSLLVLTRKHFLDYFDAVIPKMILRKMDKIKTFNILNDFSP
VEPNSSSLMETNPLEWPERHVLQNLETFEKTKQKMRTGSLPHSSEQLLGHKEGPRDSITL
LDAKELLKYFTSDGLPIGDLQPLPIQKGEKTFVLTPELSPGKLQVLPFEKASVCHYHGIE
YCLDDRKALERDGGFSELQSRLIRYETQTTCTRESFPVPTVLSPLPSPVVSSDPGSVPDG
EVLQNELRTEVSRLKRRSKDLNCLYPRKRLVKSESSESLLSQTTGNSNHYHHHVTSRKPQ
TERSLPVTCPLVPIPSCETPKLATKTSSGQKSMHESKTSRQIKESRSQKHTRILKEVVTE
TLKKHSITETHECFTACSQRLFEISKFYLKDLKTSRGLFEEMKKTANNNAVQVIDWVLEK
TSKK
NT seq 2715 nt   +upstreamnt  +downstreamnt
atggatcggtacctgctgctggtgatctggggggaaggaaaattcccgtcggcggccagt
agggaggcagaacatgggccagaggtgtcgtcgggtgagggtactgagaatcagccggac
ttcacagcagcaaatgtttatcacctcttgaaaagaagcattagtgcttcaattaatcca
gaagatagtactttccctgcctgttcagtgggaggtatacctggttccaagaagtggttc
tttgcagtgcaggcaatatatggattttatcagttttgtagttctgattggcaagagata
cattttgatacagaaaaagataaaattgaagatgttcttcaaacgaatatcgaagaatgt
ttgggtgctgttgagtgttttgaagaagaagacagtaatagcagggaatcattatccttg
gctgatctctatgaagaagctgcagaaaatttgcatcagctgtcagacaagcttcctgct
cctggtagagcaatggtagatataatactgttgctttctgacaaagatcctcctaaattg
aaagactatttacctactgtaggagcattaaaacatttgagagaatggtattcagcaaag
atcactatagcaggaaatcattgtgaaataaactgtcagaaaattgcagaatacctttct
gctaatgttgtatctttagaagatctcagaaatgttattgactcaaaggaattatggagg
gggaaaatacagatatgggaaagaaagtttggatttgaaattagttttcctgaattttgt
ttaaagggagtcacacttaagaattttagtacttctaatttaaatactgacttccttgcc
aaaaagatcataccatcaaaggataagaatattttgccaaaggttttccattattatggc
cctgctttagaatttgtgcagatgataaaattatcagatctaccctcctgctatatgtcg
gatattgaatttgagttaggattgacaaacagtaccaaacagaattctgtgttgctgttg
gagcagatttcttctctgtgtagcaaggttggtgctctttttgtattgccatgtaccatt
agtaacatactgattccacctcccaaccaactcagttcaagaaaatggaaggaatatata
gctaaaaagcctaaaacaatcagtgttccagatgttgaagtgaaaggagagtgttctagc
tattatctcttgttacaaggtaatggcaatagaagatgtaaagccacattgattcactca
gccaaccagatcaatggctcatttgcactcaatttaattcatggaaagatgaaaacaaag
acagaagaagccaaattgagttttccttttgacttattatcacttccacatttttctggg
gagcagattgtacagagagagaaacagttagctaatgttcaagttttagctttggaagaa
tgcctaaaaagacgaaagttggcaaagcagcctgaaacagtttctgttgctgaactcaaa
agtctgttagtactcacaaggaaacactttttagattattttgatgctgtgattcctaaa
atgattctaagaaagatggacaaaattaaaaccttcaatatattaaatgattttagtcca
gtggaacctaattcctcaagtctaatggaaaccaatcctctggaatggccagaaaggcat
gttcttcaaaatttggaaacttttgaaaaaactaaacaaaaaatgagaactggttcatta
cctcattcatctgaacagttgctgggccacaaagagggtcctcgggactcaatcacattg
ttggatgctaaagaattgctgaagtactttacctcagatggattacccattggagatctt
caacctttaccgattcaaaagggggaaaagacttttgttttgacaccagaacttagtcct
gggaaacttcaggtcttaccttttgagaaagcctcagtatgtcattatcatggaattgaa
tattgcttggatgaccgaaaagctttggaaagagatggaggattttctgaacttcagtct
cgtcttattcgttatgaaactcaaactacctgcaccagagaaagttttccagtacctact
gtgttgagccctcttccatctcctgtagtttcgtcagatcctggaagtgtccctgacgga
gaagttttacaaaatgaacttcgaactgaagtatcccgattgaaacggagatctaaagat
ctgaattgcctttatcccagaaaaagacttgtgaaatctgaaagttcagagtctcttctt
tctcagacaactggtaatagtaatcactatcatcatcatgtgacatccagaaagccacaa
acagaacggtccttaccagtgacttgtccattggttccaattcctagctgtgaaactcca
aaacttgctacaaagaccagttcaggtcaaaaaagtatgcatgaatcaaaaacatcaagg
caaattaaggaatcaagatcacagaaacacacacggatactgaaagaagtagttactgaa
accctgaagaaacacagtattaccgagactcatgaatgtttcactgcatgcagccagcgt
ctctttgaaatctctaagttctatctaaaggatcttaaaacttcaaggggtctatttgaa
gaaatgaagaaaacagcaaacaacaatgctgtacaggtgattgactgggtattagaaaag
acaagcaagaaatga

DBGET integrated database retrieval system