KEGG   Homo sapiens (human): 27178
Entry
27178             CDS       T01001                                 
Symbol
IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H, IL-1H4, IL-1RP1, IL-23, IL-37, IL1F7, IL1H4, IL1RP1
Name
(RefSeq) interleukin 37
  KO
K05485  interleukin 37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01269  IL18/37 to IL18R signaling
Disease
H01227  Inflammatory bowel disease (IBD)
H01466  Ulcerative colitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    27178 (IL37)
   04061 Viral protein interaction with cytokine and cytokine receptor
    27178 (IL37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    27178 (IL37)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   27178 (IL37)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 27178
NCBI-ProteinID: NP_055254
OMIM: 605510
HGNC: 15563
Ensembl: ENSG00000125571
Pharos: Q9NZH6(Tbio)
UniProt: Q9NZH6
Structure
LinkDB
Position
2:112911165..112918882
AA seq 218 aa
MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKF
SIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCL
YCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTS
CNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtcctttgtgggggagaactcaggagtgaaaatgggctctgaggactgggaaaaagat
gaaccccagtgctgcttagaagacccggctggaagccccctggaaccaggcccaagcctc
cccaccatgaattttgttcacacaagtccaaaggtgaagaacttaaacccgaagaaattc
agcattcatgaccaggatcacaaagtactggtcctggactctgggaatctcatagcagtt
ccagataaaaactacatacgcccagagatcttctttgcattagcctcatccttgagctca
gcctctgcggagaaaggaagtccgattctcctgggggtctctaaaggggagttttgtctc
tactgtgacaaggataaaggacaaagtcatccatcccttcagctgaagaaggagaaactg
atgaagctggctgcccaaaaggaatcagcacgccggcccttcatcttttatagggctcag
gtgggctcctggaacatgctggagtcggcggctcaccccggatggttcatctgcacctcc
tgcaattgtaatgagcctgttggggtgacagataaatttgagaacaggaaacacattgaa
ttttcatttcaaccagtttgcaaagctgaaatgagccccagtgaggtcagcgattag

DBGET integrated database retrieval system