KEGG   Homo sapiens (human): 27339
Entry
27339             CDS       T01001                                 
Symbol
PRPF19, NMP200, PRP19, PSO4, SNEV, UBOX4, hPSO4
Name
(RefSeq) pre-mRNA processing factor 19
  KO
K10599  pre-mRNA-processing factor 19 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    27339 (PRPF19)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    27339 (PRPF19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    27339 (PRPF19)
   04121 Ubiquitin system [BR:hsa04121]
    27339 (PRPF19)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    27339 (PRPF19)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     27339 (PRPF19)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    27339 (PRPF19)
 Complex C
   Prp19-CDC5 complex
    27339 (PRPF19)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  U-box type E3
   27339 (PRPF19)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    27339 (PRPF19)
SSDB
Motif
Pfam: WD40 Prp19 ANAPC4_WD40 NBCH_WD40 U-box eIF2A Ge1_WD40 Nup160 Cytochrom_D1 zf-Nse DUF1830 Cep57_MT_bd
Other DBs
NCBI-GeneID: 27339
NCBI-ProteinID: NP_055317
OMIM: 608330
HGNC: 17896
Ensembl: ENSG00000110107
Vega: OTTHUMG00000167798
Pharos: Q9UMS4(Tbio)
UniProt: Q9UMS4
Structure
LinkDB
Position
11:complement(60890547..60906585)
AA seq 504 aa
MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHP
IRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARL
TKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKA
TVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTG
GADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQ
VVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHP
DGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD
LRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTG
VAFGHHAKFIASTGMDRSLKFYSL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgtccctaatctgctccatctctaacgaagtgccggagcacccatgtgtatcccctgtc
tctaatcatgtttatgagcggcggctcatcgagaagtacattgcggagaatggtaccgac
cccatcaacaaccagcctctctccgaggagcagctcatcgacatcaaagttgctcaccca
atccggcccaagcctccctcagccaccagcatcccggccattctgaaagctttgcaggat
gagtgggatgcagtcatgctgcacagcttcactctgcgccagcagctgcagacaacccgc
caagagctgtcacacgctctgtaccagcacgatgccgcctgccgtgtcattgcccgtctc
accaaggaagtcactgctgcccgagaagctctggctaccctgaaaccacaggctggcctc
attgtgccccaggctgtgccaagttcccaaccaagtgttgtgggtgcgggtgagccaatg
gatttgggtgagctggtgggaatgaccccagagattattcagaagcttcaagacaaagcc
actgtgctaaccacggagcgcaagaagagagggaagactgtgcctgaggagctggtgaag
ccagaagagctcagcaaataccggcaggtggcatcccacgtggggttgcacagtgccagc
attcctgggatcctggccctggacctctgcccgtccgacaccaacaagatcctcactggt
ggggcggataaaaatgtcgttgtgtttgacaaaagttctgaacaaatcctggctaccctc
aaaggccataccaagaaggtcaccagcgtggtgtttcacccttcccaggacctggtgttt
tctgcttcccccgatgccactatcaggatttggtcggtccccaatgcctcttgtgtacag
gtggttcgggcccatgagagtgctgtgacaggcctcagccttcatgccactggcgactat
ctcctgagctcctccgatgatcagtactgggctttctctgacatccagacagggcgtgtg
ctcaccaaggtgacagatgagacctccggctgctctctcacctgtgcacagttccaccct
gacggactcatctttggaacaggaaccatggactctcagatcaagatctgggacttgaag
gaacgtactaatgtggccaacttccctggccactcgggccccatcactagcatcgccttc
tctgagaatggttactacctggctacagcggctgatgactcctctgtcaagctctgggat
ctgcgcaagcttaagaactttaagactttgcagctggataacaactttgaggtaaagtca
ctgatctttgaccagagtggtacctacctggctcttgggggcacggatgtccagatctac
atctgcaaacaatggacggagattcttcactttacagagcatagcggcctgaccacaggg
gtggccttcgggcatcacgccaagttcatcgcttcaacaggcatggacagaagcctcaag
ttctacagcctgtag

DBGET integrated database retrieval system