KEGG   Homo sapiens (human): 275
Entry
275               CDS       T01001                                 

Gene name
AMT, GCE, GCST, GCVT, NKH
Definition
(RefSeq) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa00670  One carbon pool by folate
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Disease
H00191  Nonketotic hyperglycinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    275 (AMT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    275 (AMT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    275 (AMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     275 (AMT)
SSDB
Motif
Pfam: GCV_T GCV_T_C
Other DBs
NCBI-GeneID: 275
NCBI-ProteinID: NP_000472
OMIM: 238310
HGNC: 473
Ensembl: ENSG00000145020
Vega: OTTHUMG00000156847
Pharos: P48728(Tbio)
UniProt: P48728 A0A024R2U7
LinkDB
Structure
PDB: 
1WSR 1WSV

Position
3p21.31
AA seq 403 aa
MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQ
YRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFT
NEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALL
ALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGA
VHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM
DFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNV
AMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgcagagggctgtaagtgtggtggcccgtctgggctttcgcctgcaggcattccccccg
gccttgtgtcgtccacttagttgcgcacaggaggtgctccgcaggacaccgctctatgac
ttccacctggcccacggcgggaaaatggtggcgtttgcgggttggagtctgccagtgcag
taccgggacagtcacactgactcgcacctgcacacacgccagcactgctcgctctttgac
gtgtctcatatgctgcagaccaagatacttggtagtgaccgggtgaagctgatggagagt
ctagtggttggagacattgcagagctaagaccaaaccaggggacactgtcgctgtttacc
aacgaggctggaggcatcttagatgacttgattgtaaccaatacttctgagggccacctg
tatgtggtgtccaacgctggctgctgggagaaagatttggccctcatgcaggacaaggtc
agggagcttcagaaccagggcagagatgtgggcctggaggtgttggataatgccctgcta
gctctgcaaggccccactgcagcccaggtactacaggccggcgtggcagatgacctgagg
aaactgcccttcatgaccagtgctgtgatggaggtgtttggcgtgtctggctgccgcgtg
acccgctgtggctacacaggagaggatggtgtggagatctcggtgccggtagcgggggca
gttcacctggcaacagctattctgaaaaacccagaggtgaagctggcagggctggcagcc
agggacagcctgcgcctggaggcaggcctctgcctgtatgggaatgacattgatgaacac
actacacctgtggagggcagcctcagttggacactggggaagcgccgccgagctgctatg
gacttccctggagccaaggtcattgttccccagctgaagggcagggtgcagcggaggcgt
gtggggttgatgtgtgagggggcccccatgcgggcacacagtcccatcctgaacatggag
ggtaccaagattggtactgtgactagtggctgcccctccccctctctgaagaagaatgtg
gcgatgggttatgtgccctgcgagtacagtcgtccagggacaatgctgctggtagaggtg
cggcggaagcagcagatggctgtagtcagcaagatgccctttgtgcccacaaactactat
accctcaagtga

DBGET integrated database retrieval system