KEGG   Homo sapiens (human): 2877
Entry
2877              CDS       T01001                                 
Symbol
GPX2, GI-GPx, GPRP, GPRP-2, GPx-2, GPx-GI, GSHPX-GI, GSHPx-2
Name
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2877 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2877 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2877 (GPX2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    2877 (GPX2)
   05016 Huntington disease
    2877 (GPX2)
   05022 Pathways of neurodegeneration - multiple diseases
    2877 (GPX2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2877 (GPX2)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 2877
NCBI-ProteinID: NP_002074
OMIM: 138319
HGNC: 4554
Ensembl: ENSG00000176153
Pharos: P18283(Tbio)
UniProt: P18283
Structure
LinkDB
Position
14:complement(64939158..64942745)
AA seq 190 aa
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK
DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctttcattgccaagtccttctatgacctcagtgccatcagcctggatggggagaag
gtagatttcaatacgttccggggcagggccgtgctgattgagaatgtggcttcgctctga
ggcacaaccacccgggacttcacccagctcaacgagctgcaatgccgctttcccaggcgc
ctggtggtccttggcttcccttgcaaccaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagtctcaagtatgtccgtcctgggggtggataccagcccaccttcacc
cttgtccaaaaatgtgaggtgaatgggcagaacgagcatcctgtcttcgcctacctgaag
gacaagctcccctacccttatgatgacccattttccctcatgaccgatcccaagctcatc
atttggagccctgtgcgccgctcagatgtggcctggaactttgagaagttcctcataggg
ccggagggagagcccttccgacgctacagccgcaccttcccaaccatcaacattgagcct
gacatcaagcgcctccttaaagttgccatatag

DBGET integrated database retrieval system