KEGG   Homo sapiens (human): 2880
Entry
2880              CDS       T01001                                 
Symbol
GPX5, EGLP, GPx-5, GSHPx-5, HEL-S-75p
Name
(RefSeq) glutathione peroxidase 5
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2880 (GPX5)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2880 (GPX5)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    2880 (GPX5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    2880 (GPX5)
   05016 Huntington disease
    2880 (GPX5)
   05022 Pathways of neurodegeneration - multiple diseases
    2880 (GPX5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2880 (GPX5)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 2880
NCBI-ProteinID: NP_001500
OMIM: 603435
HGNC: 4557
Ensembl: ENSG00000224586
Pharos: O75715(Tbio)
UniProt: O75715 V9HWN8
Structure
LinkDB
Position
6:28525881..28534955
AA seq 221 aa
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYV
GKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLK
YVRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIR
WNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK
NT seq 666 nt   +upstreamnt  +downstreamnt
atgactacacagttaagggtcgtccatctgcttccccttctcctagcctgctttgtgcaa
acaagtcccaagcaggagaagatgaagatggattgccacaaagacgagaaaggcaccatc
tatgactatgaggccatcgcacttaataagaatgaatatgtttccttcaagcagtatgtg
ggcaagcacatcctcttcgtcaacgtggccacctactgtggtctgacagcgcaatatcct
gaactaaatgcactccaggaggagctgaagccctatggtctagttgtgttgggctttccc
tgcaaccaatttggaaagcaagaaccaggagataacaaagagattcttcctgggctcaag
tatgtccgtccagggggaggatttgtacctagtttccagctttttgagaaaggggatgtg
aatggtgaaaaagaacagaaagtcttcagtttcttgaagcactcctgtcctcatccctct
gagattttgggcacattcaaatctatatcctgggaccctgtaaaggtccatgacatccgt
tggaactttgaaaagttcctggtggggcctgatggaatccctgtcatgcgctggtcccac
cgggctacggtcagctcagtcaagacagacatcctggcgtacttgaagcaattcaaaacc
aaatag

DBGET integrated database retrieval system