KEGG   Homo sapiens (human): 29109
Entry
29109             CDS       T01001                                 
Symbol
FHOD1, FHOS
Name
(RefSeq) formin homology 2 domain containing 1
  KO
K23938  FH1/FH2 domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01131  Salmonella SopE/E2 to RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29109 (FHOD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    29109 (FHOD1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  Formin homology (FH) domain-containing proteins
   29109 (FHOD1)
SSDB
Motif
Pfam: FH2 Formin_GBD_N
Other DBs
NCBI-GeneID: 29109
NCBI-ProteinID: NP_037373
OMIM: 606881
HGNC: 17905
Ensembl: ENSG00000135723
Vega: OTTHUMG00000137521
Pharos: Q9Y613(Tbio)
UniProt: Q9Y613
Structure
LinkDB
Position
16:complement(67229389..67247481)
AA seq 1164 aa
MAGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHR
LLGAPLKLEDCALQVSPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRV
NAILEKLYSSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYI
LRALGQLMLFVDGMLGVVAHSDTIQWLYTLCASLSRLVVKTALKLLLVFVEYSENNAPLF
IRAVNSVASTTGAPPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDA
LEQQGMEALVQRHLGTAGTDVDLRTQLVLYENALKLEDGDIEEAPGAGGRRERRKPSSEE
GKRSRRSLEGGGCPARAPEPGPTGPASPVGPTSSTGPALLTGPASSPVGPPSGLQASVNL
FPTISVAPSADTSSERSIYKARFLENVAAAETEKQVALAQGRAETLAGAMPNEAGGHPDA
RQLWDSPETAPAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLS
IGDLDFSDLGEDEDQDMLNVESVEAGKDIPAPSPPLPLLSGVPPPPPLPPPPPIKGPFPP
PPPLPLAAPLPHSVPDSSALPTKRKTVKLFWRELKLAGGHGVSASRFGPCATLWASLDPV
SVDTARLEHLFESRAKEVLPSKKAGEGRRTMTTVLDPKRSNAINIGLTTLPPVHVIKAAL
LNFDEFAVSKDGIEKLLTMMPTEEERQKIEEAQLANPDIPLGPAENFLMTLASIGGLAAR
LQLWAFKLDYDSMEREIAEPLFDLKVGMEQLVQNATFRCILATLLAVGNFLNGSQSSGFE
LSYLEKVSEVKDTVRRQSLLHHLCSLVLQTRPESSDLYSEIPALTRCAKVDFEQLTENLG
QLERRSRAAEESLRSLAKHELAPALRARLTHFLDQCARRVAMLRIVHRRVCNRFHAFLLY
LGYTPQAAREVRIMQFCHTLREFALEYRTCRERVLQQQQKQATYRERNKTRGRMITETEK
FSGVAGEAPSNPSVPVAVSSGPGRGDADSHASMKSLLTSRPEDTTHNRRSRGMVQSSSPI
MPTVGPSTASPEEPPGSSLPSDTSDEIMDLLVQSVTKSSPRALAARERKRSRGNRKSLRR
TLKSGLGDDLVQALGLSKGPGLEV
NT seq 3495 nt   +upstreamnt  +downstreamnt
atggcgggcggggaagaccgcggggacggagagccggtatcagtggtgaccgtgagggtg
cagtacctggaagacaccgaccccttcgcatgtgccaactttccggagccgcgccgggcc
cccacctgcagcctggacggggcgctgcccttgggcgcgcagatacccgcggtgcaccgc
ctgctgggagcgccgctcaagttggaggattgtgctctgcaagtgtctccctccggatac
tacctggacaccgagctgtccctggaagagcagcgggagatgctggagggcttctatgaa
gagatcagcaaagggcggaagcccacgctgatccttcggacccagctctctgtgagggtc
aacgctatcttggaaaagctgtatagctccagtggtcctgagctccgccgctccctcttc
tcactgaagcagatcttccaggaggacaaagacctggtgcctgaatttgtgcattcagag
gggctgagctgcctgatccgtgtgggtgctgctgccgaccacaactaccagagctacatc
cttagagcgctcggccagctgatgctctttgtggatggaatgctgggggtggtggcccac
agtgacactattcagtggctgtacacattgtgtgccagcctgtcccgcttggtggtgaag
acagccctgaagctgctgttggtgtttgtagaatactccgaaaacaacgcaccgctgttc
atccgtgcagtgaactctgtggccagcaccaccggtgctcctccctgggccaatctggtg
tccatcctggaggagaagaatggcgctgaccctgagttgttggtgtacacggtcaccctc
atcaacaagacgctggcggcgctcccggaccaggactccttctacgatgtgacggatgca
ctggagcagcagggcatggaagcgctggtccagcgccacctgggcactgcgggcactgac
gtcgacctgcgcacgcagcttgtgctctacgagaacgccctgaaattggaggatggagac
atcgaagaagccccaggcgctggtgggcggcgggaacgacgaaagccttcttctgaggag
ggcaagaggagccgccgttctctggaaggcgggggctgccccgcgcgtgccccggaacct
ggccccacaggccccgcctcaccggtaggccccacctcttccaccggccccgccctgctg
acaggccccgcctccagccctgtgggccctccctccggtctccaagcttcagtgaacctt
tttcctaccatctctgtggcaccctcagctgacacctccagcgagaggagcatctacaaa
gcccggttcctggagaatgtggcggcagcagaaacagagaagcaggttgcgctggcccag
ggccgggcagagacacttgccggggccatgcccaatgaggcgggtggacacccagatgcc
cggcaactctgggactccccagagacagcccctgcagccagaacaccccagagccctgcc
ccctgtgtcctgctccgggcccagcgaagccttgcaccagagcccaaggagccactgata
ccagcaagccccaaggctgagcccatctgggagctccctacccgtgcacccaggctctct
attggggacctggacttttcagatctaggggaggatgaagaccaggacatgctgaatgta
gagtctgtggaggctgggaaagacatcccagctccctcacccccactgcccctgctctcg
ggagtacccccccctcccccacttccacctcccccacccatcaaaggccccttcccacca
cctccacctctacctctggctgcccctcttccccattcagtgcctgacagctcagccctc
cccactaagaggaagacagtaaaacttttctggcgtgagctgaagctggctgggggccat
ggagtctctgcaagccgctttgggccctgcgccaccctctgggcttcactggaccctgtc
tcagtggacacggcccgactggaacacctctttgagtctcgtgccaaagaggtgctgccc
tccaagaaagctggagagggccgccggacaatgaccacagtgctggaccccaagcgcagc
aacgccatcaacatcggcctaaccacactgccacctgtgcatgtcattaaggctgctctg
ctcaactttgatgagtttgctgtcagcaaggatggcattgagaagctactgaccatgatg
cccacggaggaagagcggcagaagattgaggaagcccagctggccaaccctgacataccc
ctgggcccagccgagaacttcctgatgactcttgcctccattggcggcctcgctgctcgt
ctacaactctgggccttcaagctggactatgacagcatggagcgggaaattgctgagcca
ctgtttgacctgaaagtgggtatggaacagctggtacagaatgccaccttccgctgcatc
ctggctaccctcctagcggtgggcaacttcctcaatggctcccagagcagcggctttgag
ctgagctacctggagaaggtgtcagaggtgaaggacacggtgcgtcgacagtcactgcta
caccatctctgctccctagtgctccagacccggcctgagtcctctgacctctattcagaa
atccctgccctgacccgctgtgccaaggtggactttgaacagctgactgagaacctgggg
cagctggagcgccggagccgggcagccgaggagagcctgcggagcttggccaagcatgag
ctggccccagccctgcgtgcccgcctcacccacttcctggaccagtgtgcccgccgtgtt
gccatgctaaggatagtgcaccgccgtgtctgcaataggttccatgccttcctgctctac
ctgggctacaccccgcaggcggcccgtgaagtgcgcatcatgcagttctgccacacgctg
cgggaatttgcgcttgagtatcggacttgccgggaacgagtgctacagcagcagcagaag
caggccacataccgtgagcgcaacaagacccggggacgcatgatcaccgagacagagaag
ttctcaggtgtggctggggaagcccccagcaacccctctgtcccagtagcagtgagcagc
gggccaggccggggagatgctgacagtcatgctagtatgaagagtctgctgaccagcagg
cctgaggacaccacacacaatcgccgcagcagaggcatggtccagagcagctccccaatc
atgcccacagtggggccctccactgcatccccagaagaacccccaggctccagtttaccc
agtgatacatcagatgagatcatggaccttctggtgcagtcagtgaccaagagcagtcct
cgtgccttagctgctagggaacgcaagcgttcccgcggcaaccgcaagtctttgagaagg
acgttgaagagtgggctcggagatgacctggtgcaggcactgggactaagcaagggtcct
ggcctggaggtgtga

DBGET integrated database retrieval system