KEGG   Homo sapiens (human): 29915
Entry
29915             CDS       T01001                                 
Symbol
HCFC2, HCF-2, HCF2
Name
(RefSeq) host cell factor C2
  KO
K27390  host cell factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00588  HSV VP16 to Oct-1-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    29915 (HCFC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    29915 (HCFC2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    29915 (HCFC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL-HCF complex
     29915 (HCFC2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    29915 (HCFC2)
SSDB
Motif
Pfam: Kelch_5 Kelch_3 Kelch_1 Kelch_4 Kelch_6 Kelch_2 fn3 DUF5944
Other DBs
NCBI-GeneID: 29915
NCBI-ProteinID: NP_037452
OMIM: 607926
HGNC: 24972
Ensembl: ENSG00000111727
UniProt: Q9Y5Z7
LinkDB
Position
12:104064531..104106524
AA seq 792 aa
MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWF
LPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPS
GLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIP
VTKGVVPSPRESHTAVIYCKKDSGSPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGT
VPLPRSLHTASVIGNKMYIFGGWVPHKGENTETSPHDCEWRCTSSFSYLNLDTTEWTTLV
SDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAP
SQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQG
SNNIVPNSINDTINSTKTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVV
DMLRKNEGPHTSANVGVLSSCLDVRTVIPETSVSSTVSSTQTMVTQQTIKTESSSTNGAV
VKDETSLTTFSTKSEVDETYALPATKISRVETHATATPFSKETPSNPVATVKAGERQWCD
VGIFKNNTALVSQFYLLPKGKQSISKVGNADVPDYSLLKKQDLVPGTGYRFRVAAINGCG
IGPFSKISEFKTCIPGFPGAPSAVRISKNVEGIHLSWEPPTSPSGNILEYSAYLAIRTAQ
IQDNPSQLVFMRIYCGLKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVR
WLQGNNKKAPLN
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggcggctcccagcctcctcaactggaggcgagtttcttccttcacggggccggtcccc
cgcgcccggcacggacaccgagcggtggccatccgggagctgatgatcatctttggaggg
ggaaatgagggcatcgcggatgagctgcacgtctacaacacggctacgaatcagtggttt
ctgccagctgttagaggagatatccctccaggctgtgctgcccatggatttgtctgtgat
ggtaccagaatattagtatttgggggaatggttgaatatggaagatacagcaatgagtta
tatgagttacaagcaagtcgttggttatggaaaaaagtgaaaccccatccccctccttct
ggtttacctccttgtcctcggcttggacatagcttctctttatatggtaacaaatgctat
ttgtttggtggcctggcaaacgaaagcgaagattcaaacaataatgttcccagatattta
aatgatttttatgagttggagctacagcatggctctggtgttgtgggttggagcattcca
gtgactaaaggggttgtgccttctccaagagaatcccacacagctgttatatattgcaaa
aaagattctggaagtcctaaaatgtatgtttttggtggaatgtgtggtgctcgcctggat
gacctatggcagcttgacttagaaactatgtcatggtcaaaaccagaaactaaagggaca
gtgccacttccacgaagccttcatacagccagtgttataggaaacaagatgtacattttt
ggtggatgggtcccacataagggggaaaatactgagacttcacctcatgattgtgaatgg
agatgtaccagttcattttcttacctaaatctggatacaacagagtggaccaccctagta
tcagattctcaggaagataaaaaaaattcaagaccaagaccaagagctggccactgtgct
gttgcaatcggcactcgattgtatttttggagtggaagagatggctacaaaaaagcactg
aatagtcaagtttgctgcaaggatctttggtatcttgatactgagaaaccaccggcacca
tctcaagtacagctgatcaaagccactaccaactcctttcatgtcaagtgggatgaagtg
tctacagttgagggctatcttttgcagttgagtacagacttgccataccaagctgcatca
tcagattcttcagcagcaccaaatatgcaaggagtcaggatggaccctcacagacaaggc
agtaataacatcgttcctaacagtatcaatgatacaataaacagcacaaaaactgaacag
ccagccacaaaagaaacttcaatgaaaaacaaaccagactttaaagcactgacggattct
aatgccattttatatccatctttggcatcaaatgcttctaatcataatagtcatgtggtg
gatatgctaaggaaaaatgaaggtcctcacacttcagcaaatgtaggtgttctaagtagt
tgcctggatgtaagaacagtaattcctgaaacatctgtatccagtactgtttccagcaca
caaactatggtaacccagcagaccattaaaactgaatcatccagtacaaatggggcagtt
gttaaagatgaaacttcactaacaacattcagtaccaaatctgaagttgatgaaacatat
gcactgcctgcaacgaagatcagccgtgtagagacacatgctacagcaacgccgttttct
aaagagactccttcaaatccagtggccacagtgaaagcgggagaacgacaatggtgtgat
gtgggaatttttaaaaataatacagctttggtgagccagttttatttgctgccaaaaggg
aagcaaagcatctcaaaggtaggaaatgcagatgtacctgactacagcttgcttaagaaa
caagatcttgttccaggcacaggatacagattcagggttgctgcaatcaatggttgtggg
ataggtcctttcagcaaaatcagtgaatttaaaacttgtattcctggttttcctggagct
ccttctgcagtcagaatttcaaagaatgttgaaggtatccacctttcctgggaacctcca
acctcaccttctggaaatattttggaatattcagcctacttggctatccgcacagcacag
atacaagataatccaagtcaacttgtgttcatgaggatttattgtggtcttaagacatca
tgtatagtaactgctgggcaacttgcaaatgcacatattgattatacatccaggcctgcc
attgtgttcaggatatcagcaaagaatgaaaagggatatggaccagctacacaagttcgg
tggcttcaaggtaacaataagaaagcacctttaaattga

DBGET integrated database retrieval system