KEGG   Homo sapiens (human): 29949
Entry
29949             CDS       T01001                                 
Symbol
IL19, IL-10C, MDA1, NG.1, ZMDA1
Name
(RefSeq) interleukin 19
  KO
K05444  interleukin 19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04630  JAK-STAT signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
nt06518  JAK-STAT signaling
  Element
N00415  IL10 family to Jak-STAT signaling pathway
N01271  IL19/20/24 to IL20R signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    29949 (IL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29949 (IL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29949 (IL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    29949 (IL19)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   29949 (IL19)
SSDB
Motif
Pfam: IL10 MIF4G
Other DBs
NCBI-GeneID: 29949
NCBI-ProteinID: NP_037503
OMIM: 605687
HGNC: 5990
Ensembl: ENSG00000142224
Pharos: Q9UHD0(Tbio)
UniProt: Q9UHD0
Structure
LinkDB
Position
1:206770773..206842981
AA seq 177 aa
MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTIL
STLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQ
CQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaagttacagtgtgtttccctttggctcctgggtacaatactgatattgtgctcagta
gacaaccacggtctcaggagatgtctgatttccacagacatgcaccatatagaagagagt
ttccaagaaatcaaaagagccatccaagctaaggacaccttcccaaatgtcactatcctg
tccacattggagactctgcagatcattaagcccttagatgtgtgctgcgtgaccaagaac
ctcctggcgttctacgtggacagggtgttcaaggatcatcaggagccaaaccccaaaatc
ttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaaactctgcggcaa
tgtcaggaacagaggcagtgtcactgcaggcaggaagccaccaatgccaccagagtcatc
catgacaactatgatcagctggaggtccacgctgctgccattaaatccctgggagagctc
gacgtctttctagcctggattaataagaatcatgaagtaatgttctcagcttga

DBGET integrated database retrieval system