KEGG   Homo sapiens (human): 3032
Entry
3032              CDS       T01001                                 
Symbol
HADHB, ECHB, MSTP029, MTPB, TP-BETA
Name
(RefSeq) hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
  KO
K07509  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Module
hsa_M00085  Fatty acid elongation in mitochondria
hsa_M00087  beta-Oxidation
Network
nt06020  beta-Oxidation in mitochondria
nt06024  Valine, leucine and isoleucine degradation
  Element
N00804  beta-Oxidation
N00856  Isoleucine degradation
Disease
H00525  Disorders of mitochondrial fatty-acid oxidation
H01352  Mitochondrial trifunctional protein deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    3032 (HADHB)
   00071 Fatty acid degradation
    3032 (HADHB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    3032 (HADHB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     3032 (HADHB)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-GeneID: 3032
NCBI-ProteinID: NP_000174
OMIM: 143450
HGNC: 4803
Ensembl: ENSG00000138029
Pharos: P55084(Tbio)
UniProt: P55084
Structure
LinkDB
Position
2:26244939..26290465
AA seq 474 aa
MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGV
RTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAA
LGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMR
KLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLE
QDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPY
GTVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATP
KVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNW
GGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgactatcttgacttacccctttaaaaatcttcccactgcatcaaaatgggccctcaga
ttttccataagacctctgagctgttcctcccagctacgagctgccccagctgtccagacc
aaaacgaagaagacgttagccaaacccaatataaggaatgttgtggtggtggatggtgtt
cgcactccatttttgctgtctggcacttcatataaagacctgatgccacatgatttggct
agagcagcgcttacgggtttgttgcatcggaccagtgtccctaaggaagtagttgattat
atcatctttggtacagttattcaggaagtgaaaacaagcaatgtggctagagaggctgcc
cttggagctggcttctctgacaagactcctgctcacactgtcaccatggcttgtatctct
gccaaccaagccatgaccacaggtgttggcttgattgcttctggccagtgtgatgtgatc
gtggcaggtggtgttgagttgatgtccgatgtccctattcgtcactcaaggaaaatgaga
aaactgatgcttgatctcaataaggccaaatctatgggccagcgactgtctttaatctct
aaattccgatttaatttcctagcacctgagctccctgcggtttctgagttctccaccagt
gagaccatgggccactctgcagaccgactggccgctgcctttgctgtttctcggctggaa
caggatgaatatgcactgcgctctcacagtctagccaagaaggcacaggatgaaggactc
ctttctgatgtggtacccttcaaagtaccaggaaaagatacagttaccaaagataatggc
atccgtccttcctcactggagcagatggccaaactaaaacctgcattcatcaagccctac
ggcacagtgacagctgcaaattcttctttcttgactgatggtgcatctgcaatgttaatc
atggcggaggaaaaggctctggccatgggttataagccgaaggcatatttgagggatttt
atgtatgtgtctcaggatccaaaagatcaactattacttggaccaacatatgctactcca
aaagttctagaaaaggcaggattgaccatgaatgatattgatgcttttgaatttcatgaa
gctttctcgggtcagattttggcaaattttaaagccatggattctgattggtttgcagaa
aactacatgggtagaaaaaccaaggttggattgcctcctttggagaagtttaataactgg
ggtggatctctgtccctgggacacccatttggagccactggctgcaggttggtcatggct
gctgccaacagattacggaaagaaggaggccagtatggcttagtggctgcgtgtgcagct
ggagggcagggccatgctatgatagtggaagcttatccaaaataa

DBGET integrated database retrieval system