KEGG   Homo sapiens (human): 3155
Entry
3155              CDS       T01001                                 
Symbol
HMGCL, HL
Name
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Module
hsa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Network
nt06024  Valine, leucine and isoleucine degradation
  Element
N00851  Leucine degradation
Disease
H00179  3-Hydroxy-3-methylglutaryl-CoA lyase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    3155 (HMGCL)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    3155 (HMGCL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    3155 (HMGCL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     3155 (HMGCL)
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-GeneID: 3155
NCBI-ProteinID: NP_000182
OMIM: 613898
HGNC: 5005
Ensembl: ENSG00000117305
Pharos: P35914(Tbio)
UniProt: P35914
Structure
LinkDB
Position
1:complement(23801885..23825429)
AA seq 325 aa
MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLI
DMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAG
AKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKI
SPAKVAEVTKKFYSMGCYEISLGDTIGVGTPGIMKDMLSAVMQEVPLAALAVHCHDTYGQ
ALANTLMALQMGVSVVDSSVAGLGGCPYAQGASGNLATEDLVYMLEGLGIHTGVNLQKLL
EAGNFICQALNRKTSSKVAQATCKL
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcagcaatgaggaaggcgcttccgcggcgactggtgggcttggcgtccctccgggct
gtcagcacctcatctatgggcactttaccaaagcgggtgaaaattgtggaagttggtccc
cgagatggactacaaaatgaaaagaatatcgtatctactccagtgaaaatcaagctgata
gacatgctttctgaagcaggactctctgttatagaaaccaccagctttgtgtctcctaag
tgggttccccagatgggtgaccacactgaagtcttgaagggcattcagaagtttcctggc
atcaactacccagtcctgaccccaaatttgaaaggcttcgaggcagcggttgctgctgga
gccaaggaagtagtcatctttggagctgcctcagagctcttcaccaagaagaacatcaat
tgttccatagaggagagttttcagaggtttgacgcaatcctgaaggcagcgcagtcagcc
aatatttctgtgcgggggtacgtctcctgtgctcttggctgcccttatgaagggaagatc
tccccagctaaagtagctgaggtcaccaagaagttctactcaatgggctgctacgagatc
tccctgggggacaccattggtgtgggcaccccagggatcatgaaagacatgctatctgct
gtcatgcaggaagtgcctctggctgccctggctgtccactgccatgacacctatggtcaa
gccctggccaacaccttgatggccctgcagatgggagtgagtgtcgtggactcttctgtg
gcaggacttggaggctgtccctacgcacagggggcatcaggaaacttggccacagaagac
ctggtctacatgctagagggcttgggcattcacacgggtgtgaatctccagaagcttctg
gaagctggaaactttatctgtcaagccctgaacagaaaaactagctccaaagtggctcag
gctacctgtaaactctga

DBGET integrated database retrieval system