KEGG   Homo sapiens (human): 3291
Entry
3291              CDS       T01001                                 
Symbol
HSD11B2, AME, AME1, HSD11K, HSD2, SDR9C3
Name
(RefSeq) hydroxysteroid 11-beta dehydrogenase 2
  KO
K00071  corticosteroid 11-beta-dehydrogenase isozyme 2 [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa04960  Aldosterone-regulated sodium reabsorption
Module
hsa_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Network
nt06019  Steroid hormone biosynthesis
  Element
N00338  Steroid hormone biosynthesis, progesterone to cortisol/cortisone
Disease
H00259  Apparent mineralocorticoid excess syndrome
H01633  High blood pressure
H01709  Glucocorticoid-induced osteonecrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    3291 (HSD11B2)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3291 (HSD11B2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-
     3291 (HSD11B2)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776
Other DBs
NCBI-GeneID: 3291
NCBI-ProteinID: NP_000187
OMIM: 614232
HGNC: 5209
Ensembl: ENSG00000176387
Pharos: P80365(Tchem)
UniProt: P80365
LinkDB
Position
16:67429801..67437553
AA seq 405 aa
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG
AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS
PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA
LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI
EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR
RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggagcgctggccttggccgtcgggcggcgcctggctgctcgtggctgcccgcgcgctg
ctgcagctgctgcgctcagacctgcgtctgggccgcccgctgctggcggcgctggcgctg
ctggccgcgctcgactggctgtgccagcgcctgctgcccccgccggccgcactcgccgtg
ctggccgccgccggctggatcgcgttgtcccgcctggcgcgcccgcagcgcctgccggtg
gccactcgcgcggtgctcatcaccggctgtgactctggttttggcaaggagacggccaag
aaactggactccatgggcttcacggtgctggccaccgtattggagttgaacagccccggt
gccatcgagctgcgtacctgctgctcccctcgcctaaggctgctgcagatggacctgacc
aaaccaggagacattagccgcgtgctagagttcaccaaggcccacaccaccagcaccggc
ctgtggggcctcgtcaacaacgcaggccacaatgaagtagttgctgatgcggagctgtct
ccagtggccactttccgtagctgcatggaggtgaatttctttggcgcgctcgagctgacc
aagggcctcctgcccctgctgcgcagctcaaggggccgcatcgtgactgtggggagccca
gcgggggacatgccatatccgtgcttgggggcctatggaacctccaaagcggccgtggcg
ctactcatggacacattcagctgtgaactccttccctggggggtcaaggtcagcatcatc
cagcctggctgcttcaagacagagtcagtgagaaacgtgggtcagtgggaaaagcgcaag
caattgctgctggccaacctgcctcaagagctgctgcaggcctacggcaaggactacatc
gagcacttgcatgggcagttcctgcactcgctacgcctggccatgtccgacctcacccca
gttgtagatgccatcacagatgcgctgctggcagctcggccccgccgccgctattacccc
ggccagggcctggggctcatgtacttcatccactactacctgcctgaaggcctgcggcgc
cgcttcctgcaggccttcttcatcagtcactgtctgcctcgagcactgcagcctggccag
cctggcactaccccaccacaggacgcagcccaggacccaaacctgagccccggcccttcc
ccagcagtggctcggtga

DBGET integrated database retrieval system