KEGG   Homo sapiens (human): 3557
Entry
3557              CDS       T01001                                 

Gene name
IL1RN, DIRA, ICIL-1RA, IL-1RN, IL-1ra, IL-1ra3, IL1F3, IL1RA, IRAP, MVCD4
Definition
(RefSeq) interleukin 1 receptor antagonist
  KO
K05481  interleukin 1 receptor antagonist
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Disease
H00084  Graft-versus-host disease
H01275  Interleukin 1 receptor antagonist deficiency (DIRA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3557 (IL1RN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3557 (IL1RN)
   04052 Cytokines and growth factors [BR:hsa04052]
    3557 (IL1RN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3557 (IL1RN)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3557 (IL1RN)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 3557
NCBI-ProteinID: NP_776214
OMIM: 147679
HGNC: 6000
Ensembl: ENSG00000136689
Vega: OTTHUMG00000131341
Pharos: P18510(Tchem)
UniProt: P18510
LinkDB
Structure
PDB: 
1ILT 1ILR 1IRA 2IRT 1IRP

Position
2q14.1
AA seq 177 aa
MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYL
QGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD
KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
NT seq 534 nt   +upstreamnt  +downstreamnt
atggaaatctgcagaggcctccgcagtcacctaatcactctcctcctcttcctgttccat
tcagagacgatctgccgaccctctgggagaaaatccagcaagatgcaagccttcagaatc
tgggatgttaaccagaagaccttctatctgaggaacaaccaactagttgctggatacttg
caaggaccaaatgtcaatttagaagaaaagatagatgtggtacccattgagcctcatgct
ctgttcttgggaatccatggagggaagatgtgcctgtcctgtgtcaagtctggtgatgag
accagactccagctggaggcagttaacatcactgacctgagcgagaacagaaagcaggac
aagcgcttcgccttcatccgctcagacagtggccccaccaccagttttgagtctgccgcc
tgccccggttggttcctctgcacagcgatggaagctgaccagcccgtcagcctcaccaat
atgcctgacgaaggcgtcatggtcaccaaattctacttccaggaggacgagtag

DBGET integrated database retrieval system