KEGG   Homo sapiens (human): 3680
Entry
3680              CDS       T01001                                 

Gene name
ITGA9, ALPHA-RLC, ITGA4L, RLC
Definition
(RefSeq) integrin subunit alpha 9
  KO
K06585  integrin alpha 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoGAP-RhoA signaling pathway
N00951  ITGA/B-RHOG-RAC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01070  ITGA/B-FAK-CDC42 signaling pathway
N01072  ITGA/B-RhoGEF-RhoA signaling pathway
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
Disease
H00590  Congenital muscular dystrophies (CMD/MDC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3680 (ITGA9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3680 (ITGA9)
   04514 Cell adhesion molecules
    3680 (ITGA9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3680 (ITGA9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3680 (ITGA9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3680 (ITGA9)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    3680 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    3680 (ITGA9)
   05414 Dilated cardiomyopathy
    3680 (ITGA9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    3680 (ITGA9)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3680 (ITGA9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 3680
NCBI-ProteinID: NP_002198
OMIM: 603963
HGNC: 6145
Ensembl: ENSG00000144668
Vega: OTTHUMG00000130815
Pharos: Q13797(Tbio)
UniProt: Q13797 Q8N6H6
LinkDB
Position
3p22.2
AA seq 1035 aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIM
NRRYTYLGYAVTAGHFSHPSTIDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGQKIN
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPGSINITAP
QCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMG
QVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGKLLLSSMDEKTLYLALGAVKNISLNIS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPT
SFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
EVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
NT seq 3108 nt   +upstreamnt  +downstreamnt
atgggcggcccggctgcgccgaggggcgccgggaggctccgcgcgctgctgctggcgctg
gtggtcgcggggatccccgcgggcgcctacaacctcgacccgcagcgccccgtgcacttc
cagggccccgctgactcgttcttcggctacgcagttctggagcatttccacgacaacacg
cgctgggtccttgtgggcgcaccaaaggcagattccaaatacagcccttcagtgaagtct
cctggggctgtgtttaagtgccgtgttcacaccaaccctgaccggagatgcaccgaactg
gacatggctcgagggaagaatcggggcacgtcctgcggaaagacctgccgggaagaccgc
gatgatgagtggatgggggtgagcctggcccgacagcccaaggctgatggccgtgtgttg
gcctgtgctcatcgctggaagaacatctactatgaagccgaccacatcctaccccatggc
ttctgctacatcatcccctccaacctccaggccaaaggcaggacgctgatcccttgctat
gaagagtataagaagaagtacggagaggaacacggctcctgccaggctgggatagcgggc
ttcttcaccgaggagctggtggtgatgggtgctccagggtcattttattgggctggaacc
atcaaagtgctgaaccttacggacaacacctatttaaaactgaacgacgaagtgatcatg
aacaggcggtacacctacctgggctacgcagtgaccgctggccacttctctcacccgtcc
accattgatgtggtaggaggtgccccacaggacaaaggcatcggcaaggtttatattttc
agagctgaccgaagatcaggcaccttaattaagatctttcaagcatcaggtaaaaagatg
ggctcttacttcggctcctccttgtgcgcagttgacctgaatggggacggcctctctgac
ctgctggtgggggcccccatgttttctgagatcagggatgagggacaggtcactgtctac
atcaacagaggaaatggagccctcgaggagcagctggctctgactggggatggtgcctac
aatgcgcactttggagagagcattgccagcctggacgatctggacaatgatgggttccca
gatgtggccattggtgcacccaaggaggatgacttcgcaggggcggtctatatctatcat
ggtgatgccggtgggatagtccctcagtactcaatgaaactgtctgggcagaagataaat
ccagtgctccggatgtttggtcagtccatatcgggaggcattgatatggatggaaatggc
tatcctgatgtcactgttggagccttcatgtccgacagcgtggttcttctcagagcaagg
cctgtcattacggtggatgtctccatcttcctcccgggctccatcaacatcacagcgcct
cagtgtcacgacggacagcagcctgtgaactgcctgaacgtcaccacctgcttcagcttc
catggcaaacacgttccaggagagattggcctgaattatgttctgatggctgacgtggcc
aaaaaggagaagggccagatgcccagggtctactttgtgctgctgggagagaccatgggt
caggtcacagagaagctgcagctgacttacatggaggagacgtgtcgtcactatgtggcc
catgtgaagcggagggtgcaggacgtcatcagcccgatcgtgtttgaagcagcctacagc
ctcagtgagcatgtgactggagaggaggagagggaactgccgcctctgacaccagttctc
cgctggaaaaagggacaaaagattgcccaaaagaatcagactgtttttgaaaggaattgc
cgttcagaggactgtgccgcagacctgcagcttcagggtaaactgctgctctccagtatg
gatgagaaaaccctgtatctagctttgggggctgtgaagaacatctccctaaacatctct
atctccaacctcggagatgatgcctatgatgccaacgtgtccttcaatgtttcccgggag
ctcttcttcatcaacatgtggcagaaggaggagatgggcatctcctgtgagctgctggaa
tcggacttcctcaaatgcagcgtgggatttcctttcatgaggtcaaagtcaaagtatgaa
ttcagcgtgatctttgatacaagccacctgtctggggaagaggaagttctcagcttcatt
gttactgctcagagtggcaacacggagcgctctgaatccctgcatgacaacaccctcgtg
ctgatggtgccactgatgcacgaggtggacacgtccatcaccggaatcatgtctccaacc
tcctttgtatatggcgagtccgtggacgcagccaacttcattcagctggatgacctggag
tgtcactttcagcccatcaatatcacccttcaggtctacaacactggcccaagcaccctt
ccagggtcatctgtcagcatctctttccctaatcgactctcatctggtggtgcagagatg
tttcatgtccaggaaatggtggtgggccaagagaagggaaactgctctttccagaaaaac
ccaactccctgcatcatccctcaagaacaagaaaatatcttccacacaatatttgctttt
ttcacaaagtctggaagaaaagtcttggactgtgaaaaaccaggaatttcttgcctaaca
gcacactgtaactttagtgctcttgctaaagaagaaagtcgtactatagacatttacatg
ctgctgaacacagaaatactgaaaaaggacagttcgtctgtcatccagttcatgtcccgc
gccaaggtgaaggtggatcctgccctaagggtggtggaaatagctcatgggaacccagaa
gaggtgacggtggtcttcgaggccctgcacaatctggagccccgtggctacgtcgtgggg
tggatcatcgccatcagtttgttggtgggaatcctcatcttcctgctgctggccgtgctg
ctctggaagatgggcttctttcgccgaaggtacaaagaaattatcgaagctgagaagaac
cggaaagagaatgaagacagttgggactgggtccagaaaaaccagtga

DBGET integrated database retrieval system