KEGG   Homo sapiens (human): 3836
Entry
3836              CDS       T01001                                 
Symbol
KPNA1, IPOA5, NPI-1, RCH2, SRP1
Name
(RefSeq) karyopherin subunit alpha 1
  KO
K23940  importin subunit alpha-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05132  Salmonella infection
hsa05164  Influenza A
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06123  TNF signaling (viruses and bacteria)
  Element
N01118  Salmonella SpvD to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    3836 (KPNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    3836 (KPNA1)
  09172 Infectious disease: viral
   05164 Influenza A
    3836 (KPNA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    3836 (KPNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3836 (KPNA1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    3836 (KPNA1)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_2 HEAT_EZ HEAT V-ATPase_H_C CTNNBL
Other DBs
NCBI-GeneID: 3836
NCBI-ProteinID: NP_002255
OMIM: 600686
HGNC: 6394
Ensembl: ENSG00000114030
Pharos: P52294(Tbio)
UniProt: P52294
Structure
LinkDB
Position
3:complement(122421902..122514939)
AA seq 538 aa
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEE
VMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDE
VISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSS
EFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLC
RGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACW
TISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDK
IEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgaccaccccaggaaaagagaactttcgcctgaaaagttacaagaacaaatctctgaat
cccgatgagatgcgcaggaggagggaggaagaaggactgcagttacgaaagcagaaaaga
gaagagcagttattcaagcggagaaatgttgctacagcagaagaagaaacagaagaagaa
gttatgtcagatggaggctttcatgaggctcagattagtaacatggagatggcaccaggt
ggtgtcatcacttctgacatgattgaaatgatattttccaaaagcccagagcaacagctt
tcagcaacacagaaattcaggaagctgctttcaaaagaacctaaccctcctattgatgaa
gttatcagcacaccaggagtagtggccaggtttgtggagttcctcaaacgaaaagagaat
tgtacactgcagtttgaatcagcttgggtactgacaaatattgcttcaggaaattctctt
cagacccgaattgtgattcaggcaggagctgtgcccatcttcatagagttgctcagctca
gagtttgaagatgtccaggaacaggcagtctgggctcttggcaacattgctggagatagt
accatgtgcagggactatgtcttagactgcaatatccttccccctcttttgcagttattt
tcaaagcaaaaccgcctgaccatgacccggaatgcagtatgggctttgtctaatctctgt
agagggaaaagtccacctccagaatttgcaaaggtttctccatgtctgaatgtgctttcc
tggttgctgtttgtcagtgacactgatgtactggctgatgcctgctgggccctctcatat
ctatcagatggacccaatgataaaattcaagcggtcatcgatgcgggagtatgtaggaga
cttgtggaactgctgatgcataatgattataaagtggtttctcctgctttgcgagctgtg
ggaaacattgtcacaggggatgatattcagacacaggtaattctgaattgctcagctctg
cagagtttattgcatttgctgagtagcccaaaggaatctatcaaaaaggaagcatgttgg
acgatatctaatattacagctggaaatagggcacagatccagactgtgatagatgccaac
attttcccagccctcattagtattttacaaactgctgaatttcggacaagaaaagaagca
gcttgggccatcacaaatgcaacttctggaggatcagctgaacagatcaagtacctagta
gaactgggttgtatcaagccgctctgtgatctcctcacggtcatggactctaagattgta
caggttgccctaaatggcttggaaaatatcctgaggcttggagaacaggaagccaaaagg
aatggcactggcattaacccttactgtgctttgattgaagaagcttatggtctggataaa
attgagttcttacagagtcatgaaaaccaggagatctaccaaaaggcctttgatcttatt
gagcattacttcgggaccgaagatgaagacagcagcattgcaccccaggttgaccttaac
cagcagcagtacatcttccaacagtgtgaggctcctatggaaggtttccagctttga

DBGET integrated database retrieval system