KEGG   Homo sapiens (human): 388585
Entry
388585            CDS       T01001                                 
Symbol
HES5, bHLHb38
Name
(RefSeq) hes family bHLH transcription factor 5
  KO
K06055  hairy and enhancer of split 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00087  NOTCH-overexpression to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    388585 (HES5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    388585 (HES5)
  09162 Cancer: specific types
   05224 Breast cancer
    388585 (HES5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    388585 (HES5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    388585 (HES5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    388585 (HES5)
SSDB
Motif
Pfam: HLH Hairy_orange FancD2
Other DBs
NCBI-GeneID: 388585
NCBI-ProteinID: NP_001010926
OMIM: 607348
HGNC: 19764
Ensembl: ENSG00000197921
Pharos: Q5TA89(Tbio)
UniProt: Q5TA89
LinkDB
Position
1:complement(2528745..2530263)
AA seq 166 aa
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcccccagcactgtggccgtggagctgctcagccccaaagagaaaaaccgactgcgg
aagccggtggtggagaagatgcgccgcgaccgcatcaacagcagcatcgagcagctgaag
ctgctgctggagcaggagttcgcgcggcaccagcccaactccaagctggagaaggccgac
atcctggagatggctgtcagctacctgaagcacagcaaagccttcgtcgccgccgccggc
cccaagagcctgcaccaggactacagcgaaggctactcgtggtgcctgcaggaggccgtg
cagttcctgacgctccacgccgccagcgacacgcagatgaagctgctgtaccacttccag
cggcccccggccgcgcccgccgcgcccgccaaggagcccaaggcgccgggcgccgcgccc
ccgcccgcgctctccgccaaggccaccgccgccgccgccgccgcgcaccagcccgcctgc
ggcctctggcggccctggtga

DBGET integrated database retrieval system