KEGG   Homo sapiens (human): 392255
Entry
392255            CDS       T01001                                 
Symbol
GDF6, BMP-13, BMP13, CDMP2, KFM, KFS, KFS1, KFSL, SGM1, SYNS4
Name
(RefSeq) growth differentiation factor 6
  KO
K20012  growth differentiation factor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
Network
nt06507  TGFB signaling
  Element
N01428  BMP signaling pathway, BMP antagonist
N01453  BMP signaling pathway
Disease
H00484  Multiple synostosis syndrome
H00837  Leber congenital amaurosis
H00852  Klippel-Feil syndrome
H01027  Microphthalmia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    392255 (GDF6)
   04390 Hippo signaling pathway
    392255 (GDF6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    392255 (GDF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    392255 (GDF6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   392255 (GDF6)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 392255
NCBI-ProteinID: NP_001001557
OMIM: 601147
HGNC: 4221
Ensembl: ENSG00000156466
Pharos: Q6KF10(Tbio)
UniProt: Q6KF10 A0A0S2A5D6
LinkDB
Position
8:complement(96142333..96160806)
AA seq 455 aa
MDTPRVLLSAVFLISFLWDLPGFQQASISSSSSSAELGSTKGMRSRKEGKMQRAPRDSDA
GREGQEPQPRPQDEPRAQQPRAQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQS
SKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPP
AGPLHVQLFPCLSPLLLDARTLDPQGAPPAGWEVFDVWQGLRHQPWKQLCLELRAAWGEL
DAGEAEARARGPQQPPPPDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFAEMREQLGSA
EAAGPGAGAEGSWPPPSGAPDARPWLPSPGRRRRRTAFASRHGKRHGKKSRLRCSKKPLH
VNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCC
VPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggatactcccagggtcctgctctcggccgtcttcctcatcagttttctgtgggatttg
cccggtttccagcaggcttccatctcatcctcctcgtcgtccgccgagctgggttccacc
aagggcatgcgaagccgcaaggaaggcaagatgcagcgggcgccgcgcgacagtgacgcg
ggccgggagggccaggaaccacagccgcggcctcaggacgaaccccgggctcagcagccc
cgggcgcaggagccgccaggcaggggtccgcgcgtggtgccccacgagtacatgctgtca
atctacaggacttactccatcgctgagaagctgggcatcaatgccagctttttccagtct
tccaagtcggctaatacgatcaccagctttgtagacaggggactagacgatctctcgcac
actcctctccggagacagaagtatttgtttgatgtgtccatgctctcagacaaagaagag
ctggtgggcgcggagctgcggctctttcgccaggcgccctcagcgccctgggggccacca
gccgggccgctccacgtgcagctcttcccttgcctttcgcccctactgctggacgcgcgg
accctggacccgcagggggcgccgccggccggctgggaagtcttcgacgtgtggcagggc
ctgcgccaccagccctggaagcagctgtgcttggagctgcgggccgcatggggcgagctg
gacgccggggaggccgaggcgcgcgcgcggggaccccagcaaccgccgcccccggacctg
cggagtctgggcttcggccggagggtgcggcctccccaggagcgggccctgctggtggta
ttcaccagatcccagcgcaagaacctgttcgcagagatgcgcgagcagctgggctcggcc
gaggctgcgggcccgggcgcgggcgccgaggggtcgtggccgccgccgtcgggcgccccg
gatgccaggccttggctgccctcgcccggccgccggcggcggcgcacggccttcgccagt
cgccatggcaagcggcacggcaagaagtccaggctacgctgcagcaagaagcccctgcac
gtgaacttcaaggagctgggctgggacgactggattatcgcgcccctggagtacgaggcc
tatcactgcgagggtgtatgcgacttcccgctgcgctcgcacctggagcccaccaaccac
gccatcatccagacgctgatgaactccatggaccccggctccaccccgcccagctgctgc
gtgcccaccaaattgactcccatcagcattctatacatcgacgcgggcaataatgtggtc
tacaagcagtacgaggacatggtggtggagtcgtgcggctgcaggtag

DBGET integrated database retrieval system