KEGG   Homo sapiens (human): 4025
Entry
4025              CDS       T01001                                 
Symbol
LPO, SPO
Name
(RefSeq) lactoperoxidase
  KO
K12550  lactoperoxidase [EC:1.11.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
hsa05208  Chemical carcinogenesis - reactive oxygen species
Network
nt06251  CYP-mediated ROS formation
  Element
N01404  17beta-estradiol to CYP-mediated metabolism
N01405  17beta-estradiol to CYP-mediated metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    4025 (LPO)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4025 (LPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     4025 (LPO)
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 4025
NCBI-ProteinID: NP_006142
OMIM: 150205
HGNC: 6678
Ensembl: ENSG00000167419
Pharos: P22079(Tbio)
UniProt: P22079
LinkDB
Position
17:58238584..58268518
AA seq 712 aa
MRVLLHLPALLASLILLQAAASTTRAQTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAM
SSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLE
VGCGAPAPVVRCDPCSPYRTITGDCNNRRKPALGAANRALARWLPAEYEDGLSLPFGWTP
GKTRNGFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSE
YSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINAL
TSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTT
ARVPCFLAGDSRASEHILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAF
VQIITFRDYLPILLGDHMQKWIPPYQGYSESVDPRISNVFTFAFRFGHLEVPSSMFRLDE
NYQPWGPEPELPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMKQNKMMTGELRNKLFQ
PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGL
YGTPDNIDIWIGAIAEPLVERGRVGPLLACLLGKQFQQIRDGDRFWWENPGVFTNEQKDS
LQKMSFSRLVCDNTRITKVPRDPFWANSYPYDFVDCSAIDKLDLSPWASVKN
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgagggtccttctccatctcccagccctcctggcttccctcatcttgcttcaggctgca
gcatctaccacaagagcgcagactaccagaacctctgccatctccgatactgtgagtcag
gccaaggtccaagtcaacaaggccttcctggactcccgaaccaggctgaagaccgccatg
agctctgagactcccaccagccgacagctctcagaatacctcaagcatgccaaaggccgg
acgcgcacagccatccgcaatggacaggtgtgggaggagtctttaaagagactgaggcag
aaggcatccttgaccaatgtcacagatcccagcctggacttgacttcactgtctctggag
gtgggctgtggtgctcctgctcccgtggtgagatgcgacccgtgcagcccttaccgcacc
attacgggagactgcaataacaggaggaagcctgcgctgggcgccgccaacagggctctg
gcgcgctggctgcccgcggagtacgaggacgggctctccctgcccttcggctggacgccg
gggaagacgcgcaacggcttccctctcccgctggcccgggaggtatctaacaagattgtt
ggctatctgaatgaggagggtgttctggaccaaaacaggtccctgctcttcatgcagtgg
ggtcagattgtggatcatgacctggactttgcccctgacaccgagctggggagtagcgag
tactccaaagcccagtgtgatgagtactgtatccagggagacaactgcttccccatcatg
ttcccacccaatgaccccaaggcggggactcaagggaaatgcatgcctttcttccgagct
gggttcgtctgccccactccaccctacaagtccctggcccgagagcagatcaacgctctg
acctccttcctggatgccagctttgtgtacagctccgagccaagcctggccagccgcctc
cgcaacctcagcagccccctgggcctcatggctgtcaaccaggaggtctcagaccatgga
ctaccctacctgccctatgacagcaagaagccaagcccctgtgagttcatcaacaccact
gcccgtgtgccctgcttcctggcaggagattctcgagcctcagagcatattctgctggcc
acatcccacaccctctttctccgcgagcataaccggctggccagagaactaaagagactc
aaccctcagtgggatggagagaagctctaccaggaagcccggaaaatcctgggagccttc
gtgcagattatcacctttagggactacctacccattttgctaggtgaccacatgcagaag
tggatacccccatatcaaggctacagtgaatctgtggatcccagaatttccaatgtcttc
accttcgccttccgctttggccacttggaggtcccctctagtatgttccgcctggatgag
aattatcagccatgggggccagaaccagaactccccctccacaccctcttcttcaacact
tggaggatggtcaaagatggtggaattgatcctctggtgcggggcctgctggccaagaaa
tccaagctgatgaaacagaataaaatgatgactggagagctgcgcaacaagcttttccag
ccaactcacaggatccatggctttgacctggctgccatcaacacacagcgttgccgggac
catgggcaacctgggtacaattcctggagagccttctgtgacctctcacagccgcagaca
ctagaggagttgaacacagtgctgaagagcaagatgctggccaagaagttactgggtctc
tacgggacccctgacaacatcgacatctggataggggccattgctgagccgctggtggaa
aggggtcgggtggggcctctcctggcctgcctcttgggcaagcagttccagcagatccgt
gatggagacaggttctggtgggaaaaccctggggtcttcacgaacgagcagaaggactct
ctacagaaaatgtccttctcacgccttgtctgtgacaacacccgcatcaccaaggtccca
cgggacccattctgggccaacagctacccctatgacttcgtggattgctcagccatcgac
aagctggacctgtcaccctgggcctcagtgaagaattag

DBGET integrated database retrieval system