Homo sapiens (human): 440093 Help Entry 440093            CDS       T01001                                  Symbol H3-5, H3.3C, H3.5, H3F3C Name (RefSeq) H3.5 histone   KO K11253   histone H3 Organism hsa  Homo sapiens (human) Pathway hsa04613   Neutrophil extracellular trap formation hsa05034   Alcoholism hsa05131   Shigellosis hsa05202   Transcriptional misregulation in cancer hsa05322   Systemic lupus erythematosus Network nt06240  Transcription (cancer)   Element N00125   IGH-MMSET fusion to transcriptional activation Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     440093 (H3-5)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     440093 (H3-5)   09171 Infectious disease: bacterial    05131 Shigellosis     440093 (H3-5)   09163 Immune disease    05322 Systemic lupus erythematosus     440093 (H3-5)   09165 Substance dependence    05034 Alcoholism     440093 (H3-5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsa03036]     440093 (H3-5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     440093 (H3-5) Chromosome and associated proteins [BR:hsa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     440093 (H3-5) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    440093 (H3-5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  440093 NCBI-ProteinID:  NP_001013721 OMIM:  616134 HGNC:  33164 Ensembl:  ENSG00000188375 UniProt:  Q6NXT2 Structure PDBPDBj LinkDB All DBs Position 12:complement(31791185..31792298) Genome browser AA seq 135 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTEL LIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIM PKDIQLARRIRGERA NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaaatccaccggtgggaaagccccccgcaaacag ctggccacgaaagctgccaggaaaagcaccccctctacctgcggggtgaagcctcatcgc tacaggcctgggaccgtggcgcttcgagagattcgtcgttatcagaagtcgaccgagctg ctcatccggaagctgcccttccagaggttggtgagggagatcgcgcaggatttcaacact gacctgaggtttcagagcgcagccgtcggtgcgctgcaggaggctagcgaagcgtacctg gtgggtctgttggaagatactaacctgtgtgccatccacgctaagagagtcaccatcatg cccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system