KEGG   Homo sapiens (human): 4591
Entry
4591              CDS       T01001                                 
Symbol
TRIM37, MUL, POB1, TEF3
Name
(RefSeq) tripartite motif containing 37
  KO
K10608  tripartite motif-containing protein 37 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Disease
H01289  Mulibrey nanism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4591 (TRIM37)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    4591 (TRIM37)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4591 (TRIM37)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    4591 (TRIM37)
SSDB
Motif
Pfam: zf-B_box MATH zf-C3HC4_3 HlyD_2 zf-C3HC4_2 MRFAP1 FUSC BORCS6
Other DBs
NCBI-GeneID: 4591
NCBI-ProteinID: NP_001005207
OMIM: 605073
HGNC: 7523
Ensembl: ENSG00000108395
Pharos: O94972(Tbio)
UniProt: O94972
Structure
LinkDB
Position
17:complement(58967201..59106880)
AA seq 964 aa
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQL
RELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALW
GGMHGGHTFKPLAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVR
EIRNAVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK
SSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQRADPVYSPP
LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSCNDPTKNII
REFASDFEVGECWGYNRFFRLDLLANEGYLNPQNDTVILRFQVRSPTFFQKSRDQHWYIT
QLEAAQTSYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDALETRAKKSACSDM
LLEGGPTTASVREAKEDEEDEEKIQNEDYHHELSDGDLDLDLVYEDEVNQLDGSSSSASS
TATSNTEENDIDEETMSGENDVEYNNMELEEGELMEDAAAAGPAGSSHGYVGSSSRISRR
THLCSAATSSLLDIDPLILIHLLDLKDRSSIENLWGLQPRPPASLLQPTASYSRKDKDQR
KQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNTLSEIKSSSAASGDMQTSLFSADQAA
LAACGTENSGRLQDLGMELLAKSSVANCYIRNSTNKKSNSPKPARSSVAGSLSLRRAVDP
GENSRSKGDCQTLSEGSPGSSQSGSRHSSPRALIHGSIGDILPKTEDRQCKALDSDAVVV
AVFSGLPAVEKRRKMVTLGANAKGGHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGM
SSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDE
NSGR
NT seq 2895 nt   +upstreamnt  +downstreamnt
atggatgaacagagcgtggagagcattgctgaggttttccgatgtttcatttgtatggag
aaattgcgggatgcacgcctgtgtcctcattgctccaaactgtgttgtttcagctgtatt
aggcgctggctgacagagcagagagctcaatgtcctcattgccgtgctccactccagcta
cgagaactagtaaattgtcgttgggcagaagaagtaacacaacagcttgatactcttcaa
ctctgcagtctcaccaaacatgaagaaaatgaaaaggacaaatgtgaaaatcaccatgaa
aaacttagtgtattttgctggacttgtaagaagtgtatctgccatcagtgtgcactttgg
ggaggaatgcatggcggacatacctttaaacctttggcagaaatttatgagcaacacgtc
actaaagtgaatgaagaggtagccaaacttcgtcggcgtctcatggaactgatcagctta
gttcaagaagtggaaaggaatgtagaagctgtaagaaatgcaaaagatgagcgtgttcgg
gaaattaggaatgcagtggagatgatgattgcacggttagacacacagctgaagaataag
cttataacactgatgggtcagaagacatctctaacccaagaaacagagcttttggaatcc
ttacttcaggaggtggagcaccagttgcggtcttgtagtaagagtgagttgatatctaag
agctcagagatccttatgatgtttcagcaagttcatcggaagcccatggcatcttttgtt
accactcctgttccaccagactttaccagtgaattagtgccatcttacgattcagctact
tttgttttagagaatttcagcactttgcgtcagagagcagatcctgtttacagtccacct
cttcaagtttcaggactttgctggaggttaaaagtttacccagatggaaatggagttgtg
cgaggttactacttatctgtgtttctggagctctcagctggcttgcctgaaacttctaaa
tatgaatatcgtgtagagatggttcaccagtcctgtaatgatcctacaaaaaatatcatt
cgagaatttgcatctgactttgaagttggagaatgctggggctataatagatttttccgt
ttggacttactcgcaaatgaaggatacttgaatccacaaaatgatacagtgattttaagg
tttcaggtacgttcaccaactttctttcaaaaatcccgggaccagcattggtacattact
cagttggaagctgcacagactagttatatccaacaaataaacaaccttaaagagagactt
actattgagctgtctcgaactcagaagtcaagagatttgtcaccaccagataaccatctt
agcccccaaaatgatgatgctctggagacacgagctaagaagtctgcatgctctgacatg
cttctcgaaggtggtcctactacagcttctgtaagagaggccaaagaggatgaagaagat
gaggagaagattcagaatgaagattatcatcacgagctttcagatggagatctggatctg
gatcttgtttatgaggatgaagtaaatcagctcgatggcagcagttcctctgctagttcc
acagcaacaagtaatacagaagaaaatgatattgatgaagaaactatgtctggagaaaat
gatgtggaatataacaacatggaattagaagagggagaactcatggaagatgcagctgct
gcaggacccgcaggtagtagccatggttatgtgggttccagtagtagaatatcaagaaga
acacatttatgctccgctgctaccagtagtttactagacattgatccattaattttaata
catttgttggaccttaaggaccggagcagtatagaaaatttgtggggcttacagcctcgc
ccacctgcttcacttctgcagcccacagcatcatattctcgaaaagataaagaccaaagg
aagcaacaggcaatgtggcgagtgccctctgatttaaagatgctaaaaagactcaaaact
caaatggccgaagttcgatgtatgaaaactgatgtaaagaatacactttcagaaataaaa
agcagcagtgctgcttctggagacatgcagacaagccttttttctgctgaccaggcagct
ctggctgcatgtggaactgaaaactctggcagattgcaggatttgggaatggaactcctg
gcaaagtcatcagttgccaattgttacatacgaaactccacaaataagaagagtaattcg
cccaagccagctcgatccagtgtagcaggtagtctatcacttcgaagagcagtggaccct
ggagaaaatagtcgttcaaagggagactgtcagactctgtctgaaggctccccaggaagc
tctcagtctgggagcaggcacagttctccccgagccttgatacatggcagtatcggtgat
attctgccaaaaactgaagaccggcagtgtaaagctttggattcagatgctgttgtggtt
gcagttttcagtggcttgcctgcggttgagaaaaggaggaaaatggtcaccttgggggct
aatgctaaaggaggtcatctggaaggactgcagatgactgatttggaaaataattctgaa
actggagagttacagcctgtactacctgaaggagcttcagctgcccctgaagaaggaatg
agtagcgacagtgacattgaatgtgacactgagaatgaggagcaggaagagcataccagt
gtgggcgggtttcacgactccttcatggtcatgacacagcccccggatgaagatacacat
tccagttttcctgatggtgaacaaataggccctgaagatctcagcttcaatacagatgaa
aatagtggaagataa

DBGET integrated database retrieval system