KEGG   Homo sapiens (human): 4613
Entry
4613              CDS       T01001                                 
Symbol
MYCN, MODED, N-myc, NMYC, ODED, bHLHe37
Name
(RefSeq) MYCN proto-oncogene, bHLH transcription factor
  KO
K09109  N-myc proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00131  Amplified MYCN to transcriptional activation
N00132  Amplified MYCN to transcriptional repression
Disease
H00043  Neuroblastoma
H00510  Feingold syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4613 (MYCN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4613 (MYCN)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    4613 (MYCN)
SSDB
Motif
Pfam: Myc_N HLH CENP-B_dimeris LRS4 TFIIF_alpha
Other DBs
NCBI-GeneID: 4613
NCBI-ProteinID: NP_001280157
OMIM: 164840
HGNC: 7559
Ensembl: ENSG00000134323
Vega: OTTHUMG00000039579
Pharos: P04198(Tbio)
UniProt: P04198
Structure
LinkDB
Position
2:15940550..15947004
AA seq 464 aa
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgccgagctgctccacgtccaccatgccgggcatgatctgcaagaacccagacctcgag
tttgactcgctacagccctgcttctacccggacgaagatgacttctacttcggcggcccc
gactcgacccccccgggggaggacatctggaagaagtttgagctgctgcccacgcccccg
ctgtcgcccagccgtggcttcgcggagcacagctccgagcccccgagctgggtcacggag
atgctgcttgagaacgagctgtggggcagcccggccgaggaggacgcgttcggcctgggg
ggactgggtggcctcacccccaacccggtcatcctccaggactgcatgtggagcggcttc
tccgcccgcgagaagctggagcgcgccgtgagcgagaagctgcagcacggccgcgggccg
ccaaccgccggttccaccgcccagtccccgggagccggcgccgccagccctgcgggtcgc
gggcacggcggggctgcgggagccggccgcgccggggccgccctgcccgccgagctcgcc
cacccggccgccgagtgcgtggatcccgccgtggtcttcccctttcccgtgaacaagcgc
gagccagcgcccgtgcccgcagccccggccagtgccccggcggcgggccctgcggtcgcc
tcgggggcgggtattgccgccccagccggggccccgggggtcgcccctccgcgcccaggc
ggccgccagaccagcggcggcgaccacaaggccctcagtacctccggagaggacaccctg
agcgattcagatgatgaagatgatgaagaggaagatgaagaggaagaaatcgacgtggtc
actgtggagaagcggcgttcctcctccaacaccaaggctgtcaccacattcaccatcact
gtgcgtcccaagaacgcagccctgggtcccgggagggctcagtccagcgagctgatcctc
aaacgatgccttcccatccaccagcagcacaactatgccgccccctctccctacgtggag
agtgaggatgcacccccacagaagaagataaagagcgaggcgtccccacgtccgctcaag
agtgtcatccccccaaaggctaagagcttgagcccccgaaactctgactcggaggacagt
gagcgtcgcagaaaccacaacatcctggagcgccagcgccgcaacgaccttcggtccagc
tttctcacgctcagggaccacgtgccggagttggtaaagaatgagaaggccgccaaggtg
gtcattttgaaaaaggccactgagtatgtccactccctccaggccgaggagcaccagctt
ttgctggaaaaggaaaaattgcaggcaagacagcagcagttgctaaagaaaattgaacac
gctcggacttgctag

DBGET integrated database retrieval system