Entry |
|
Symbol |
NDUFS5, CI-15k, CI15K
|
Name |
(RefSeq) NADH:ubiquinone oxidoreductase subunit S5
|
KO |
K03938 | NADH dehydrogenase (ubiquinone) Fe-S protein 5 |
|
Organism |
|
Pathway |
hsa04723 | Retrograde endocannabinoid signaling |
hsa04932 | Non-alcoholic fatty liver disease |
hsa05022 | Pathways of neurodegeneration - multiple diseases |
hsa05208 | Chemical carcinogenesis - reactive oxygen species |
|
Module |
hsa_M00143 | NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria |
|
Network |
|
Element |
N00995 | Electron transfer in Complex I |
N00997 | Mutation-caused aberrant Abeta to electron transfer in Complex I |
N01042 | Mutation-caused aberrant SNCA to electron transfer in Complex I |
N01043 | Mutation-inactivated PINK1 to electron transfer in Complex I |
N01044 | MPP+ to electron transfer in Complex I |
N01045 | Rotenone to electron transfer in Complex I |
N01136 | Mutation-caused aberrant TDP43 to electron transfer in Complex I |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
4725 (NDUFS5)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
4725 (NDUFS5)
09159 Environmental adaptation
04714 Thermogenesis
4725 (NDUFS5)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
4725 (NDUFS5)
09164 Neurodegenerative disease
05010 Alzheimer disease
4725 (NDUFS5)
05012 Parkinson disease
4725 (NDUFS5)
05014 Amyotrophic lateral sclerosis
4725 (NDUFS5)
05016 Huntington disease
4725 (NDUFS5)
05020 Prion disease
4725 (NDUFS5)
05022 Pathways of neurodegeneration - multiple diseases
4725 (NDUFS5)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
4725 (NDUFS5)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
4725 (NDUFS5)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
LinkDB |
|
Position |
1:39026350..39034615
|
AA seq |
106 aa
MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY
DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP |
NT seq |
321 nt +upstreamnt +downstreamnt
atgcctttcttggacatccagaaaaggttcggccttaacatagatcgatggttgacaatc
cagagtggtgaacagccctacaagatggctggtcgatgccatgcttttgaaaaagaatgg
atagaatgtgcacatggaatcggttatactcgggcagagaaagagtgcaagatagaatat
gatgatttcgtagagtgtttgcttcggcagaaaacgatgagacgtgcaggtaccatcagg
aagcagcgggataagctgataaaggaaggaaagtacacccctccacctcaccacattggc
aagggggagcctcggccctga |