KEGG   Homo sapiens (human): 4799
Entry
4799              CDS       T01001                                 
Symbol
NFX1, NFX2, TEG-42, Tex42
Name
(RefSeq) nuclear transcription factor, X-box binding 1
  KO
K12236  transcriptional repressor NF-X1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05165  Human papillomavirus infection
Network
nt06116  NOTCH signaling (viruses)
nt06140  Transcription (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00373  HPV E6 to NFX1-mediated transcription
N00382  HPV E6 to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    4799 (NFX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4799 (NFX1)
   04121 Ubiquitin system [BR:hsa04121]
    4799 (NFX1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other zinc fingers
    4799 (NFX1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   NFX1 proteins
    4799 (NFX1)
SSDB
Motif
Pfam: R3H zf-NF-X1 XPG_I
Other DBs
NCBI-GeneID: 4799
NCBI-ProteinID: NP_002495
OMIM: 603255
HGNC: 7803
Ensembl: ENSG00000086102
Vega: OTTHUMG00000019772
Pharos: Q12986(Tbio)
UniProt: Q12986
LinkDB
Position
9:33290516..33371157
AA seq 1120 aa
MAEAPPVSGTFKFNTDAAEFIPQEKKNSGLNCGTQRRLDSNRIGRRNYSSPPPCHLSRQV
PYDEISAVHQHSYHPSGSKPKSQQTSFQSSPCNKSPKSHGLQNQPWQKLRNEKHHIRVKK
AQSLAEQTSDTAGLESSTRSESGTDLREHSPSESEKEVVGADPRGAKPKKATQFVYSYGR
GPKVKGKLKCEWSNRTTPKPEDAGPESTKPVGVFHPDSSEASSRKGVLDGYGARRNEQRR
YPQKRPPWEVEGARPRPGRNPPKQEGHRHTNAGHRNNMGPIPKDDLNERPAKSTCDSENL
AVINKSSRRVDQEKCTVRRQDPQVVSPFSRGKQNHVLKNVETHTGSLIEQLTTEKYECMV
CCELVRVTAPVWSCQSCYHVFHLNCIKKWARSPASQADGQSGWRCPACQNVSAHVPNTYT
CFCGKVKNPEWSRNEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFMTKTCECG
RTRHTVRCGQAVSVHCSNPCENILNCGQHQCAELCHGGQCQPCQIILNQVCYCGSTSRDV
LCGTDVGKSDGFGDFSCLKICGKDLKCGNHTCSQVCHPQPCQQCPRLPQLVRCCPCGQTP
LSQLLELGSSSRKTCMDPVPSCGKVCGKPLPCGSLDFIHTCEKLCHEGDCGPCSRTSVIS
CRCSFRTKELPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLR
CGLHRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARVHECDH
PVYHSCHSEEKCPPCTFLTQKWCMGKHEFRSNIPCHLVDISCGLPCSATLPCGMHKCQRL
CHKGECLVDEPCKQPCTTPRADCGHPCMAPCHTSSPCPVTACKAKVELQCECGRRKEMVI
CSEASSTYQRIAAISMASKITDMQLGGSVEISKLITKKEVHQARLECDEECSALERKKRL
AEAFHISEDSDPFNIRSSGSKFSDSLKEDARKDLKFVSDVEKEMETLVEAVNKGKNSKKS
HSFPPMNRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAIRGKSVCPPTTLTGVLEREM
QARPPPPIPHHRHQSDKNPGSSNLQKITKEPIIDYFDVQD
NT seq 3363 nt   +upstreamnt  +downstreamnt
atggcggaggcgcctcctgtctcaggtacttttaaattcaatacagatgctgctgaattc
attcctcaggagaaaaaaaattctggtctaaattgtgggactcaaaggagactagactct
aataggattggtagaagaaattacagttcaccacctccctgtcacctttccaggcaggtc
ccttatgatgaaatctctgctgttcatcagcatagttatcatccgtcaggaagcaaacct
aagagtcagcagacgtctttccagtcctctccttgtaataaatcgcccaagagccatggc
cttcagaatcaaccttggcagaaattgaggaatgagaagcaccatatcagagtcaagaaa
gcacagagtcttgctgagcagacctcagatacagctggattagagagctcgaccagatca
gagagtgggacagacctcagagagcatagtccttctgagagtgagaaggaagttgtgggt
gcagatcccaggggagcaaaacccaaaaaagcaacacagtttgtatacagctatggtaga
ggaccaaaagtcaaggggaaactcaaatgtgaatggagtaaccgaacaactccaaaaccg
gaggatgctggacccgaaagtaccaaacctgtgggggttttccaccctgactcttcagag
gcatcctctagaaaaggagtattggatgggtatggagccagacgaaatgagcagagaaga
tacccacagaaaaggcctccctgggaagtggagggggccaggccacgaccaggcagaaat
ccaccaaaacaggagggccaccgacatacaaacgcaggacacagaaacaacatgggcccc
attccaaaggatgacctcaatgaaagaccagcaaaatctacctgtgacagtgagaacttg
gcagtcatcaacaagtcttccaggagggttgaccaagagaaatgcactgtacggaggcag
gatcctcaagtagtatctcctttctcccgaggcaaacagaaccatgtgctaaagaatgtg
gaaacgcacacaggttctctaattgaacaactaacaacagaaaaatacgagtgcatggtg
tgctgtgaattggttcgtgtcacggccccagtgtggagttgtcagagctgttaccatgtg
tttcatttgaactgcataaagaaatgggcaaggtctccagcatctcaagcagatggccag
agtggttggaggtgccctgcctgtcagaatgtttctgcacatgttcctaatacctacact
tgtttctgtggcaaggtaaagaatcctgagtggagcagaaatgaaattccacatagctgt
ggtgaggtttgtagaaagaaacagcctggccaggactgcccacattcctgtaaccttctc
tgccatccaggaccctgcccaccctgccctgcctttatgacaaaaacatgtgaatgtgga
cgaaccaggcacacagttcgctgtggtcaggctgtctcagtccactgttctaacccatgt
gagaatattttgaactgtggtcagcaccagtgtgctgagctgtgccatgggggtcagtgc
cagccttgccagatcattttgaaccaggtatgctattgcggcagcacctcccgagatgtg
ttatgtggaaccgatgtaggaaagtctgatggatttggggatttcagctgtttaaagata
tgtggcaaggacttgaaatgcggtaaccatacatgttcgcaagtgtgccaccctcagccc
tgccagcaatgcccacggctcccccagctggtgcgctgttgcccctgtggccaaactcct
ctcagccaattgctagaacttggaagtagtagtcggaaaacatgcatggaccctgtgcct
tcatgtggaaaagtgtgcggcaagcctctgccttgtggttccttagatttcattcatacc
tgtgaaaagctctgccatgaaggagactgtggaccatgctctcgcacatcagttatttcc
tgcagatgctctttcagaacaaaggagcttccatgtaccagtctcaaaagtgaagatgct
acatttatgtgtgacaagcggtgtaacaagaaacggttgtgtggacggcataaatgtaat
gagatatgctgtgtggataaggagcacaagtgtcctttgatttgtgggaggaaactccgt
tgtggccttcataggtgtgaagaaccttgtcatcgtggaaactgccagacatgctggcaa
gccagttttgatgaattaacctgccattgtggtgcatcagtgatttaccctccagttccc
tgtggtactaggccccctgaatgtacccaaacctgcgctagagtccatgagtgtgaccat
ccagtatatcattcttgtcatagtgaggagaagtgtcccccttgcactttcctaactcag
aagtggtgcatgggcaagcatgagtttcggagcaacatcccctgtcacctggttgatatc
tcttgcggattaccctgcagtgccacgctaccatgtgggatgcacaaatgtcagagactc
tgtcacaaaggggagtgtcttgtggatgagccctgcaagcagccctgcaccacccccaga
gctgactgtggtcacccgtgtatggcaccctgccataccagctcaccctgccctgtgact
gcttgtaaagctaaggtagagctacagtgtgaatgtggacgaagaaaagagatggtgatt
tgctctgaagcatctagtacttatcaaagaatagctgcaatctccatggcctctaagata
acagacatgcagcttggaggttcagtggagatcagcaagttaattaccaaaaaggaagtt
catcaagccaggctggagtgtgatgaggagtgttcagccttggaaaggaaaaagagatta
gcagaggcatttcatatcagtgaggattctgatcctttcaatatacgttcttcagggtca
aaattcagtgatagtttgaaagaagatgccaggaaggacttaaagtttgtcagtgacgtt
gagaaggaaatggaaaccctcgtggaggccgtgaataagggaaagaatagtaagaaaagc
cacagcttccctcccatgaacagagaccaccgccggatcatccatgacttggcccaagtt
tatggcctggagagcgtgagctatgacagtgaaccgaagcgcaatgtggtggtcactgcc
atcagggggaagtccgtttgtcctcctaccacgctgacaggtgtgcttgaaagggaaatg
caggcacggcctccaccaccgattcctcatcacagacatcagtcagacaagaatcctggg
agcagtaatttacagaaaataaccaaggagccaataattgactattttgacgtccaggac
taa

DBGET integrated database retrieval system